CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_024209m
FamilyGH18
Protein PropertiesLength: 306 Molecular Weight: 33826.6 Isoelectric Point: 4.5992
ChromosomeChromosome/Scaffold: 03750 Start: 349566 End: 350483
Description
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18392268.3e-23
  AEFNNVKFTDVPINPNVDFHFILSFAIDYDTSSSPSPTNGKFNVFWDSENLSPSDVSSIKNQYSNVKVALSLGGDSVQGGYAYFNPSSVNSWVSNAVSTL
  TDIIKQYNLDGIDIDDEHFQADPETFTECIGQLISTLKKNSVISFASIAPFDDDQVQSHYQALWKKYGELIDYVNFQFYAYDQGTTVS
Full Sequence
Protein Sequence     Length: 306     Download
MELSKLFVTL LILQALIPSH SSIQAAPKNS NLFREYIGAE FNNVKFTDVP INPNVDFHFI    60
LSFAIDYDTS SSPSPTNGKF NVFWDSENLS PSDVSSIKNQ YSNVKVALSL GGDSVQGGYA    120
YFNPSSVNSW VSNAVSTLTD IIKQYNLDGI DIDDEHFQAD PETFTECIGQ LISTLKKNSV    180
ISFASIAPFD DDQVQSHYQA LWKKYGELID YVNFQFYAYD QGTTVSQFMG YFQTQSSNYN    240
GGKVLVSFIS DGSGGLGPDD GFFTACSKLK SQKQLHGIFV WSADDSKANG FRYEKQSQAL    300
LAIHH* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06546GH18_CTS3_chitinase1.0e-5100217129+
smart00636Glyco_183.0e-658231188+
cd00598GH18_chitinase-like6.0e-1051217172+
pfam00704Glyco_hydro_181.0e-1258219171+
cd06544GH18_narbonin8.0e-11232286256+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN76732.1012921284hypothetical protein [Vitis vinifera]
EMBLCAN76732.1012305295588hypothetical protein [Vitis vinifera]
RefSeqXP_002281665.1013051304PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318148.1063052301predicted protein [Populus trichocarpa]
RefSeqXP_002532811.1013051305Chitinase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3sim_B0323012273A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB3sim_A0323012273A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB1nar_A4e-37323024288A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation II3.2.1.14-RXNEC-3.2.1.14chitinase
chitin degradation IIRXN-12623EC-3.2.1.14chitinase
chitin degradation IIRXN-12624EC-3.2.1.14chitinase
chitin degradation III (carnivorous plants)3.2.1.14-RXNEC-3.2.1.14chitinase
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY61835029893040
FQ316586266373020
FQ317099266373020
FQ316492265373010
FQ317155266373020
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_046_00008.1Aquca_014_00353.1Aquca_010_00636.1Aquca_027_00184.1
Brachypodium distachyonBradi3g26850.1Bradi3g26810.1Bradi3g26840.1
Carica papayaevm.model.supercontig_139.6
Citrus clementinaCiclev10028881mCiclev10003729m
Citrus sinensisorange1.1g021511morange1.1g046094m
Eucalyptus grandisEucgr.B02439.1Eucgr.J02106.1
Fragaria vescamrna14033.1-v1.0-hybrid.59.211mrna14019.1-v1.0-hybridmrna15882.1-v1.0-hybridmrna14034.1-v1.0-hybridmrna17899.1-v1.0-hybrid
mrna22564.1-v1.0-hybrid
Glycine maxGlyma11g15512.1Glyma09g21615.1Glyma13g40590.1
Gossypium raimondiiGorai.003G135700.1Gorai.003G135800.1Gorai.003G134100.1Gorai.003G129600.1Gorai.011G120000.1
Gorai.003G138400.1
Linum usitatissimumLus10005172
Malus domesticaMDP0000904158MDP0000885802MDP0000644797MDP0000312089
Manihot esculentacassava4.1_027074m
Medicago truncatulaMedtr6g079630.1Medtr2g096030.1
Mimulus guttatusmgv1a019267mmgv1a024804m
Oryza sativaLOC_Os10g28050.1LOC_Os10g28080.1
Panicum virgatumPavirv00061810mPavirv00014582mPavirv00031712m
Phaseolus vulgarisPhvul.011G069900.1
Picea abiesMA_38396g0010MA_10427109g0010
Populus trichocarpaPotri.012G102400.1Potri.015G100500.1Potri.015G100600.1Potri.001G341700.1
Prunus persicappa023801mppa009038mppa009096m
Ricinus communis30039.m00023530039.m000234
Setaria italicaSi022612mSi026720mSi028172mSi036765mSi036774m
Selaginella moellendorffii41118115493
Sorghum bicolorSb01g021920.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny