CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_025536m
FamilyAA2
Protein PropertiesLength: 350 Molecular Weight: 38433.8 Isoelectric Point: 6.2602
ChromosomeChromosome/Scaffold: 06814 Start: 876272 End: 877515
DescriptionPeroxidase superfamily protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2543110
  RSELQQVFATNIGQAAGLLRLQFHDCFVQGCDGSILLERGSERTEIPNRTLRPEAFQILENLRQIVHAQCGLVVSCSDILTIAARDSVVLSGGPDYEVPL
  GRRDGVTFAPVNQTLIDLIPATANVSTIISQFSRKNLNVTDVVALSGAHTIGISSCSSFTNRLYPTIDPTMDPAFAASLMQICPSLDSTNVAVLDVRSPN
  TFDNQYYANLFSRQGLLNSDQNIRRDARTLGYVTRFFTNQTFFFRMFVDSMVKMGQVD
Full Sequence
Protein Sequence     Length: 350     Download
MATATYFACL LLISSTLMGF SFSVIQAQSR PPIVNGLSWT FYQTTCPQLE AIIRSELQQV    60
FATNIGQAAG LLRLQFHDCF VQGCDGSILL ERGSERTEIP NRTLRPEAFQ ILENLRQIVH    120
AQCGLVVSCS DILTIAARDS VVLSGGPDYE VPLGRRDGVT FAPVNQTLID LIPATANVST    180
IISQFSRKNL NVTDVVALSG AHTIGISSCS SFTNRLYPTI DPTMDPAFAA SLMQICPSLD    240
STNVAVLDVR SPNTFDNQYY ANLFSRQGLL NSDQNIRRDA RTLGYVTRFF TNQTFFFRMF    300
VDSMVKMGQV DVLTGTQGEI RANCFRRNSD NLDLLSVAKE NLGSSSTMR* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like4.0e-2453309286+
pfam00141peroxidase5.0e-5853204152+
PLN03030PLN030303.0e-6841324297+
cd00693secretory_peroxidase8.0e-14136326302+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK52084.1043407346peroxidase [Nicotiana tabacum]
GenBankAAS97959.20103495347peroxidase precursor [Euphorbia characias]
GenBankACK57683.102634926357peroxidase 4 [Litchi chinensis]
RefSeqXP_002524320.1013491353Peroxidase 12 precursor, putative [Ricinus communis]
RefSeqXP_002527092.101934920354Peroxidase 12 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bgp_A0293281305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1qo4_A0373283304A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1pa2_A0373283304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B0373282294A Chain A, Peanut Peroxidase
PDB1sch_A0373282294A Chain A, Peanut Peroxidase
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG295322271102760
CK269332308223250
CU531725302393360
CK266019305223220
EG68841228612820
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_114_00002.1Aquca_023_00176.2Aquca_023_00176.1Aquca_023_00171.1Aquca_023_00181.1
Aquca_023_00178.1Aquca_023_00180.1Aquca_023_00179.1
Arabidopsis lyrata895007
Arabidopsis thalianaAT1G71695.1
Brachypodium distachyonBradi3g13590.1Bradi3g33940.1Bradi2g09600.1Bradi4g27680.1Bradi5g27130.1
Bradi5g27150.1Bradi2g17120.1Bradi5g27220.1Bradi5g27210.1Bradi5g27200.1
Bradi5g27170.1Bradi5g27160.1
Brassica rapaBra003918Bra016127
Carica papayaevm.model.supercontig_49.84
Capsella rubellaCarubv10020541m
Citrus clementinaCiclev10001726m
Citrus sinensisorange1.1g019278m
Eucalyptus grandisEucgr.I00020.1Eucgr.F04198.1Eucgr.F04195.1Eucgr.L02740.1Eucgr.J02563.1
Fragaria vescamrna27591.1-v1.0-hybrid
Glycine maxGlyma16g27890.1Glyma10g36680.1Glyma20g30910.1Glyma16g27880.1Glyma16g27900.1
Glyma10g36690.1Glyma16g27900.3
Gossypium raimondiiGorai.010G131800.1Gorai.005G077600.1
Linum usitatissimumLus10028735Lus10028689
Malus domesticaMDP0000176436.181.349MDP0000176436.181.349MDP0000642832
Manihot esculentacassava4.1_010796mcassava4.1_025889mcassava4.1_032882mcassava4.1_031254mcassava4.1_010776m
cassava4.1_027775mcassava4.1_013268mcassava4.1_021820m
Medicago truncatulaMedtr1g106870.1
Mimulus guttatusmgv1a009174m
Oryza sativaLOC_Os08g02110.1LOC_Os01g73220.1LOC_Os01g73170.1LOC_Os01g73200.1LOC_Os04g59150.1
LOC_Os01g73190.1LOC_Os04g59160.1LOC_Os04g59200.1LOC_Os04g59210.1LOC_Os04g59260.1
LOC_Os04g59190.1LOC_Os04g59150.2
Panicum virgatumPavirv00006034mPavirv00009935mPavirv00047812mPavirv00054325mPavirv00068704m
Pavirv00024512mPavirv00006543mPavirv00052301mPavirv00016398mPavirv00020256m
Pavirv00002644m
Phaseolus vulgarisPhvul.007G082600.1Phvul.007G082700.1Phvul.004G090800.1
Picea abiesMA_62726g0010MA_10427332g0010MA_10432033g0020MA_10275776g0010MA_66200g0010
MA_497337g0010MA_57932g0010MA_13490g0020MA_8813326g0010MA_10430613g0010.304.542
MA_10430613g0010.304.542MA_10432865g0020MA_10115394g0010MA_73034g0010MA_1125g0010.202.340
MA_1125g0010.202.340MA_170633g0010MA_466251g0010
Populus trichocarpaPotri.005G195600.1Potri.002G065300.1Potri.005G195700.1
Prunus persicappa007748m
Ricinus communis28644.m00090129863.m00107629863.m001072
Setaria italicaSi001960mSi002014mSi022514mSi002007mSi022669m
Si022524mSi022622m
Selaginella moellendorffii177321230656
Sorghum bicolorSb06g033840.1Sb03g046810.1Sb03g046760.1Sb06g033870.1Sb06g033850.1
Sb06g033860.1
Thellungiella halophilaThhalv10018753mThhalv10018936m
Vitis viniferaGSVIVT01034574001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)