y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_026132m
FamilyGT77
Protein PropertiesLength: 156 Molecular Weight: 18369.2 Isoelectric Point: 9.4208
ChromosomeChromosome/Scaffold: 03852 Start: 317961 End: 318428
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT7711252.1e-33
  MWIRDPFLHFYEDADFQIACDIYNGHPFDRKNKPNGGFNYVKSNKRTMEFYKFWYLSRKAYPGLNDQDVLNKIKHDPFIAKLGLQMRFLDTAYFGGFCAR
  TKNFNSVCTVHANCCIGLEVKAHDL
Full Sequence
Protein Sequence     Length: 156     Download
MWIRDPFLHF YEDADFQIAC DIYNGHPFDR KNKPNGGFNY VKSNKRTMEF YKFWYLSRKA    60
YPGLNDQDVL NKIKHDPFIA KLGLQMRFLD TAYFGGFCAR TKNFNSVCTV HANCCIGLEV    120
KAHDLKIVLE DWRRFLLIPP NLKPSSSFSW RAPQKC                              180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-401125133+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002270758.101156112267PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311563.101156122277predicted protein [Populus trichocarpa]
RefSeqXP_002329694.101156200355predicted protein [Populus trichocarpa]
RefSeqXP_002521882.101156220375pentatricopeptide repeat-containing protein, putative [Ricinus communis]
RefSeqXP_002533447.1011561156conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT50895115611560
DT51983915611560
JG62930415611560
CN49692815411540
GO56151315521560
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00097.1Aquca_053_00106.1Aquca_002_01394.1Aquca_040_00051.1Aquca_053_00096.1
Arabidopsis thalianaAT5G44820.1AT4G19970.1.489.686AT4G19970.1.489.686AT1G28710.3AT1G28710.2
AT1G28710.1AT1G28700.1AT2G02061.1AT1G14590.1AT4G19970.1.149.346
AT4G19970.1.149.346AT4G15970.1AT1G28695.1AT5G40900.1
Brachypodium distachyonBradi2g59017.1Bradi1g52610.1Bradi2g58994.1Bradi5g19577.1Bradi1g09720.1
Bradi3g51990.1Bradi1g76460.1Bradi1g01750.1Bradi1g01760.1Bradi2g58987.1
Bradi1g49780.1Bradi4g34530.1Bradi4g34540.1Bradi2g59010.1Bradi4g34570.1
Bradi3g41140.1Bradi2g59027.1Bradi4g34590.1Bradi4g34520.1Bradi2g59001.1
Brassica rapaBra025100Bra025101Bra012524Bra014090Bra002916
Bra024835Bra013434Bra027575Bra014901Bra038406
Bra028479Bra021946
Carica papayaevm.model.supercontig_13.215evm.model.supercontig_30.146evm.model.supercontig_2.84evm.model.supercontig_2596.1evm.model.supercontig_1017.2
Capsella rubellaCarubv10026625mCarubv10004249m.489.686Carubv10004249m.489.686Carubv10019169mCarubv10009619m
Carubv10009437mCarubv10004249m.147.344Carubv10004249m.147.344Carubv10027641mCarubv10027757m
Carubv10007406mCarubv10011614mCarubv10012005mCarubv10006582m
Citrus clementinaCiclev10010447mCiclev10020796mCiclev10006749mCiclev10008749mCiclev10008659m
Ciclev10018179mCiclev10018159m
Citrus sinensisorange1.1g040326morange1.1g017526morange1.1g016761morange1.1g044643morange1.1g018473m
orange1.1g017033morange1.1g016995morange1.1g038629m
Cucumis sativusCucsa.256730.1Cucsa.194020.1Cucsa.377380.1Cucsa.112460.1
Eucalyptus grandisEucgr.A02942.1Eucgr.K00112.1Eucgr.H00616.2Eucgr.H00616.1Eucgr.G02042.1
Eucgr.D01203.1Eucgr.E01659.1
Fragaria vescamrna00598.1-v1.0-hybridmrna21406.1-v1.0-hybridmrna09286.1-v1.0-hybridmrna05326.1-v1.0-hybrid
Glycine maxGlyma16g34240.2Glyma16g34260.2Glyma03g25600.2Glyma03g25590.2Glyma07g13220.2
Glyma07g19600.2Glyma20g24350.1Glyma20g00871.2Glyma20g00871.1Glyma10g42700.2
Glyma16g34271.2Glyma16g34271.1Glyma16g34250.2Glyma09g34480.4Glyma09g34480.3
Glyma09g34480.2Glyma09g34480.1Glyma16g34280.1Glyma09g29670.1Glyma17g21810.2
Glyma16g06180.1
Gossypium raimondiiGorai.004G068600.1Gorai.005G155400.2Gorai.005G155400.1Gorai.004G068700.1Gorai.008G110400.1
Gorai.008G169200.2Gorai.008G169200.1
Linum usitatissimumLus10017981Lus10034422Lus10019139Lus10017982Lus10032455
Lus10031330Lus10031903Lus10031927Lus10041973Lus10041976
Lus10041977Lus10041975
Malus domesticaMDP0000197874MDP0000234123MDP0000298955MDP0000305973.152.349MDP0000305973.152.349
MDP0000305973.476.673MDP0000305973.476.673MDP0000785615MDP0000646858MDP0000309587
MDP0000248652MDP0000225024MDP0000215737
Manihot esculentacassava4.1_021057mcassava4.1_008667mcassava4.1_026163mcassava4.1_009155m
Medicago truncatulaMedtr1g034810.1Medtr6g081060.1AC202489_10.1Medtr1g044340.1
Mimulus guttatusmgv1a007746mmgv1a013635mmgv1a024088mmgv1a020419mmgv1a011268m
mgv1a007657mmgv1a022000mmgv1a009278m
Oryza sativaLOC_Os03g03730.1LOC_Os07g19444.1LOC_Os04g49590.1LOC_Os03g52160.1LOC_Os01g69140.1
LOC_Os02g46120.2LOC_Os02g46120.1LOC_Os03g63270.1LOC_Os03g63280.1LOC_Os01g69160.1
LOC_Os08g41800.1LOC_Os01g69200.1LOC_Os01g69190.1
Panicum virgatumPavirv00048073mPavirv00036490mPavirv00004969mPavirv00061166mPavirv00001745m
Pavirv00001744mPavirv00029787mPavirv00013532mPavirv00004840mPavirv00048329m
Pavirv00045318mPavirv00060429mPavirv00065844mPavirv00029786mPavirv00008953m
Pavirv00004842mPavirv00060898mPavirv00032687mPavirv00010532mPavirv00040930m
Pavirv00043582mPavirv00029788mPavirv00040931mPavirv00010531mPavirv00015487m
Pavirv00037239mPavirv00053993mPavirv00031613mPavirv00061238mPavirv00055330m
Pavirv00050538mPavirv00041792m
Physcomitrella patensPp1s68_81V6.1Pp1s98_155V6.1Pp1s69_44V6.1.146.245Pp1s69_44V6.1.146.245Pp1s98_155V6.3
Pp1s68_125V6.1Pp1s111_58V6.1Pp1s69_44V6.1.62.138Pp1s69_44V6.1.62.138Pp1s98_155V6.2
Phaseolus vulgarisPhvul.007G020400.1Phvul.010G044600.1Phvul.010G044400.1Phvul.003G008500.1Phvul.004G142200.1
Phvul.004G142100.1Phvul.004G142300.1Phvul.001G094600.2Phvul.001G094600.1
Picea abiesMA_501889g0010MA_132232g0010MA_607856g0010MA_10428482g0010MA_10432108g0010
MA_10434802g0010MA_386090g0010MA_8135787g0010MA_373999g0010MA_184747g0010
MA_898978g0010MA_10433997g0010MA_140045g0010MA_9004089g0010MA_179108g0010
MA_10429744g0010MA_6668110g0010MA_8547205g0010MA_175330g0010MA_955315g0010
MA_37650g0010
Populus trichocarpaPotri.014G051600.1Potri.012G037300.1Potri.015G029200.3Potri.015G029200.2Potri.015G029200.1
Potri.012G114800.1Potri.012G113200.1Potri.012G112600.1Potri.010G099400.2Potri.010G099400.1
Potri.002G139800.1Potri.008G142200.2Potri.008G142200.1Potri.015G110600.1
Prunus persicappa007679mppa022545mppa006741mppa021342mppa017327m
ppa018804mppa020835mppa008443m
Ricinus communis29780.m00136629709.m00118330147.m01436428613.m00013930190.m010943
Setaria italicaSi036243mSi029892mSi040232mSi001490mSi032504m
Si039211mSi017461mSi012694mSi036241mSi035913m
Si002012mSi013954mSi003819mSi003892mSi027875m
Si030349mSi032505mSi004175mSi030341mSi001867m
Sorghum bicolorSb03g044030.1Sb01g048460.1Sb06g026610.1Sb02g009460.2Sb02g009460.1
Sb03g044020.1Sb04g031550.1Sb01g001260.1Sb07g026310.1Sb01g001250.1
Sb02g029220.1Sb02g019390.1Sb03g044060.1Sb03g044050.1Sb03g044040.1
Sb01g009150.1Sb03g044070.1
Thellungiella halophilaThhalv10025579mThhalv10000930mThhalv10000936mThhalv10000933mThhalv10028197m
Thhalv10029163mThhalv10027358mThhalv10011621mThhalv10025388mThhalv10004358m
Thhalv10025491mThhalv10000928mThhalv10026960mThhalv10001209mThhalv10026780m
Thhalv10009446mThhalv10009695mThhalv10026794m
Vitis viniferaGSVIVT01018317001GSVIVT01029389001.419.532GSVIVT01029389001.419.532GSVIVT01018316001GSVIVT01010291001
GSVIVT01024334001GSVIVT01029389001.108.221GSVIVT01029389001.108.221
Zea maysAC211891.4_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)