Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_026308m |
Family | GH28 |
Protein Properties | Length: 121 Molecular Weight: 12896.5 Isoelectric Point: 6.2312 |
Chromosome | Chromosome/Scaffold: 12409 Start: 15598 End: 15960 |
Description | Pectin lyase-like superfamily protein |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH28 | 2 | 121 | 6.2e-40 |
IRFNFITKGLVRDITSLNSNYFHVNVLGCDDFAFEGFKVSTPEGSLNMDGIHIGRSKGVTISNVKIGTGDDCISIGDRTENLKITKVACGPGHGISIGSL GKYENEDPVSGITISNCTLT |
Full Sequence |
---|
Protein Sequence Length: 121 Download |
NIRFNFITKG LVRDITSLNS NYFHVNVLGC DDFAFEGFKV STPEGSLNMD GIHIGRSKGV 60 TISNVKIGTG DDCISIGDRT ENLKITKVAC GPGHGISIGS LGKYENEDPV SGITISNCTL 120 T |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN03003 | PLN03003 | 5.0e-23 | 15 | 120 | 106 | + Probable polygalacturonase At3g15720 | ||
PLN02793 | PLN02793 | 2.0e-25 | 12 | 121 | 110 | + Probable polygalacturonase | ||
PLN02155 | PLN02155 | 1.0e-26 | 1 | 121 | 121 | + polygalacturonase | ||
pfam00295 | Glyco_hydro_28 | 2.0e-39 | 1 | 121 | 121 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
PLN02188 | PLN02188 | 4.0e-42 | 1 | 121 | 121 | + polygalacturonase/glycoside hydrolase family protein |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAA89476.1 | 0 | 1 | 121 | 148 | 268 | polygalacturonase [Salix gilgiana] |
DDBJ | BAA89477.1 | 0 | 1 | 121 | 148 | 268 | polygalacturonase [Salix gilgiana] |
RefSeq | XP_002269648.1 | 0 | 1 | 121 | 118 | 238 | PREDICTED: hypothetical protein, partial [Vitis vinifera] |
RefSeq | XP_002329175.1 | 0 | 1 | 121 | 148 | 268 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002333303.1 | 0 | 1 | 121 | 148 | 268 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1bhe_A | 0.0000002 | 14 | 104 | 166 | 263 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
PDB | 1nhc_F | 0.0000006 | 45 | 121 | 149 | 223 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
PDB | 1nhc_E | 0.0000006 | 45 | 121 | 149 | 223 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
PDB | 1nhc_D | 0.0000006 | 45 | 121 | 149 | 223 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
PDB | 1nhc_C | 0.0000006 | 45 | 121 | 149 | 223 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
homogalacturonan degradation | RXN-2103 | EC-3.2.1.15 | polygalacturonase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GO513613 | 120 | 1 | 120 | 0 |
GW611463 | 121 | 1 | 121 | 0 |
FC885548 | 121 | 1 | 121 | 0 |
FG346830 | 120 | 1 | 120 | 0 |
FG346874 | 120 | 1 | 120 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|