| Basic Information | |
|---|---|
| Species | Manihot esculenta |
| Cazyme ID | cassava4.1_026308m |
| Family | GH28 |
| Protein Properties | Length: 121 Molecular Weight: 12896.5 Isoelectric Point: 6.2312 |
| Chromosome | Chromosome/Scaffold: 12409 Start: 15598 End: 15960 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH28 | 2 | 121 | 6.2e-40 |
| IRFNFITKGLVRDITSLNSNYFHVNVLGCDDFAFEGFKVSTPEGSLNMDGIHIGRSKGVTISNVKIGTGDDCISIGDRTENLKITKVACGPGHGISIGSL GKYENEDPVSGITISNCTLT | |||
| Full Sequence |
|---|
| Protein Sequence Length: 121 Download |
| NIRFNFITKG LVRDITSLNS NYFHVNVLGC DDFAFEGFKV STPEGSLNMD GIHIGRSKGV 60 TISNVKIGTG DDCISIGDRT ENLKITKVAC GPGHGISIGS LGKYENEDPV SGITISNCTL 120 T 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN03003 | PLN03003 | 5.0e-23 | 15 | 120 | 106 | + Probable polygalacturonase At3g15720 | ||
| PLN02793 | PLN02793 | 2.0e-25 | 12 | 121 | 110 | + Probable polygalacturonase | ||
| PLN02155 | PLN02155 | 1.0e-26 | 1 | 121 | 121 | + polygalacturonase | ||
| pfam00295 | Glyco_hydro_28 | 2.0e-39 | 1 | 121 | 121 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
| PLN02188 | PLN02188 | 4.0e-42 | 1 | 121 | 121 | + polygalacturonase/glycoside hydrolase family protein | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAA89476.1 | 0 | 1 | 121 | 148 | 268 | polygalacturonase [Salix gilgiana] |
| DDBJ | BAA89477.1 | 0 | 1 | 121 | 148 | 268 | polygalacturonase [Salix gilgiana] |
| RefSeq | XP_002269648.1 | 0 | 1 | 121 | 118 | 238 | PREDICTED: hypothetical protein, partial [Vitis vinifera] |
| RefSeq | XP_002329175.1 | 0 | 1 | 121 | 148 | 268 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002333303.1 | 0 | 1 | 121 | 148 | 268 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1bhe_A | 0.0000002 | 14 | 104 | 166 | 263 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
| PDB | 1nhc_F | 0.0000006 | 45 | 121 | 149 | 223 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_E | 0.0000006 | 45 | 121 | 149 | 223 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_D | 0.0000006 | 45 | 121 | 149 | 223 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_C | 0.0000006 | 45 | 121 | 149 | 223 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| homogalacturonan degradation | RXN-2103 | EC-3.2.1.15 | polygalacturonase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| GO513613 | 120 | 1 | 120 | 0 |
| GW611463 | 121 | 1 | 121 | 0 |
| FC885548 | 121 | 1 | 121 | 0 |
| FG346830 | 120 | 1 | 120 | 0 |
| FG346874 | 120 | 1 | 120 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |