| Basic Information | |
|---|---|
| Species | Manihot esculenta |
| Cazyme ID | cassava4.1_026577m |
| Family | GT1 |
| Protein Properties | Length: 144 Molecular Weight: 15910.9 Isoelectric Point: 4.945 |
| Chromosome | Chromosome/Scaffold: 06908 Start: 5551 End: 6445 |
| Description | UDP-glucosyl transferase 76E12 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT1 | 13 | 101 | 9.9e-25 |
| RGLIVKWATQQEVLAHPATGGFWTHNGWNSTLESFCEGVPMICQPNFGDQMVNARYVSSVWGVGIHLENNLDRGNVESAIKRLMMEEAS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 144 Download |
| PLPDGFLEMI RDRGLIVKWA TQQEVLAHPA TGGFWTHNGW NSTLESFCEG VPMICQPNFG 60 DQMVNARYVS SVWGVGIHLE NNLDRGNVES AIKRLMMEEA SKFEGETTLE KRKGEEAQTT 120 TDSQSNGTNS RLIPSIRITS LSL* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00201 | UDPGT | 1.0e-25 | 15 | 102 | 88 | + UDP-glucoronosyl and UDP-glucosyl transferase. | ||
| PLN02992 | PLN02992 | 1.0e-25 | 2 | 113 | 116 | + coniferyl-alcohol glucosyltransferase | ||
| PLN02555 | PLN02555 | 1.0e-27 | 2 | 117 | 116 | + limonoid glucosyltransferase | ||
| PLN00164 | PLN00164 | 6.0e-30 | 2 | 96 | 102 | + glucosyltransferase; Provisional | ||
| PLN02410 | PLN02410 | 9.0e-45 | 2 | 129 | 128 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_002276843.1 | 0 | 2 | 122 | 335 | 449 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002281324.1 | 0 | 2 | 122 | 319 | 433 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002334160.1 | 2.00386e-43 | 1 | 114 | 320 | 426 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002520467.1 | 3.00018e-42 | 2 | 133 | 315 | 446 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
| RefSeq | XP_002530398.1 | 5.00264e-43 | 1 | 125 | 311 | 438 | UDP-glucuronosyltransferase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2pq6_A | 1e-25 | 6 | 119 | 347 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2c9z_A | 5e-24 | 2 | 102 | 315 | 416 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2c1z_A | 5e-24 | 2 | 102 | 315 | 416 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2c1x_A | 5e-24 | 2 | 102 | 315 | 416 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 3hbj_A | 1e-20 | 2 | 99 | 317 | 415 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| BP932015 | 98 | 2 | 98 | 0 |
| BP931106 | 98 | 2 | 98 | 0 |
| AJ774738 | 98 | 2 | 98 | 0 |
| BP935319 | 98 | 2 | 98 | 0 |
| GH629143 | 98 | 2 | 98 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
