Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_028386m |
Family | CBM43 |
Protein Properties | Length: 86 Molecular Weight: 9240.2 Isoelectric Point: 4.2641 |
Chromosome | Chromosome/Scaffold: 03859 Start: 527107 End: 527464 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 83 | 5.7e-32 |
WCVAKPATEDDMLQENINFSCNHVDCSPIQDGGSCFSPTTLMNHAAFAMNLYYQSTGRGSNSCEFRGTGLLVTTNPGYGNC |
Full Sequence |
---|
Protein Sequence Length: 86 Download |
ETWCVAKPAT EDDMLQENIN FSCNHVDCSP IQDGGSCFSP TTLMNHAAFA MNLYYQSTGR 60 GSNSCEFRGT GLLVTTNPGY GNCTF* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-18 | 2 | 71 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 6.0e-33 | 2 | 85 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_177973.4 | 6e-30 | 1 | 85 | 30 | 114 | unknown protein [Arabidopsis thaliana] |
RefSeq | XP_002300444.1 | 2e-29 | 1 | 85 | 30 | 114 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002519722.1 | 5.00264e-43 | 1 | 85 | 132 | 216 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002528491.1 | 3e-30 | 1 | 85 | 32 | 116 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-28 | 2 | 85 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE256344 | 86 | 1 | 86 | 8.00141e-43 |
EE255611 | 86 | 1 | 86 | 1.99965e-42 |
EE260061 | 72 | 15 | 86 | 6e-33 |
EE255611 | 85 | 1 | 85 | 2e-21 |
EE256344 | 49 | 37 | 85 | 0.0000001 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|