| Basic Information | |
|---|---|
| Species | Manihot esculenta |
| Cazyme ID | cassava4.1_028563m |
| Family | GH28 |
| Protein Properties | Length: 150 Molecular Weight: 15875.1 Isoelectric Point: 9.6404 |
| Chromosome | Chromosome/Scaffold: 11456 Start: 127278 End: 127841 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH28 | 1 | 138 | 2.8e-40 |
| IGSLGEHSHEDGVQNVTVAATVFKGTQNGVRIKSWGRPSSGFASNIVFRNIVMKNAYNPIIIDQKYCPSGHGCPHQNSGVKISGVTYEKIRGTSVTQVAM NFICSSSNPCRGIKMQGINLTYFNRPIATSVCVNAHGT | |||
| Full Sequence |
|---|
| Protein Sequence Length: 150 Download |
| IGSLGEHSHE DGVQNVTVAA TVFKGTQNGV RIKSWGRPSS GFASNIVFRN IVMKNAYNPI 60 IIDQKYCPSG HGCPHQNSGV KISGVTYEKI RGTSVTQVAM NFICSSSNPC RGIKMQGINL 120 TYFNRPIATS VCVNAHGTAS GSVLPPSCF* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02218 | PLN02218 | 1.0e-29 | 1 | 145 | 145 | + polygalacturonase ADPG | ||
| pfam00295 | Glyco_hydro_28 | 2.0e-33 | 1 | 140 | 140 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
| PLN02188 | PLN02188 | 2.0e-35 | 1 | 148 | 151 | + polygalacturonase/glycoside hydrolase family protein | ||
| PLN02793 | PLN02793 | 7.0e-41 | 1 | 149 | 149 | + Probable polygalacturonase | ||
| PLN02155 | PLN02155 | 3.0e-55 | 1 | 149 | 149 | + polygalacturonase | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_002275740.1 | 0 | 1 | 148 | 242 | 388 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002331632.1 | 0 | 1 | 149 | 242 | 391 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002529093.1 | 0 | 1 | 149 | 172 | 319 | Polygalacturonase precursor, putative [Ricinus communis] |
| RefSeq | XP_002529094.1 | 0 | 1 | 149 | 242 | 390 | Polygalacturonase precursor, putative [Ricinus communis] |
| RefSeq | XP_002529095.1 | 0 | 1 | 149 | 242 | 390 | Polygalacturonase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1bhe_A | 0.000001 | 12 | 88 | 261 | 336 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
| PDB | 2iq7_G | 0.000003 | 1 | 121 | 202 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_F | 0.000003 | 1 | 121 | 202 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_E | 0.000003 | 1 | 121 | 202 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_D | 0.000003 | 1 | 121 | 202 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| homogalacturonan degradation | RXN-2103 | EC-3.2.1.15 | polygalacturonase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| ES984224 | 150 | 1 | 150 | 0 |
| EE255801 | 150 | 1 | 150 | 0 |
| JG080212 | 150 | 1 | 150 | 0 |
| JG076996 | 150 | 1 | 150 | 0 |
| JG077291 | 150 | 1 | 150 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |