Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_029297m |
Family | GH28 |
Protein Properties | Length: 151 Molecular Weight: 16698.8 Isoelectric Point: 6.3836 |
Chromosome | Chromosome/Scaffold: 10800 Start: 9381 End: 9833 |
Description | Pectin lyase-like superfamily protein |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH28 | 2 | 151 | 0 |
LRFDFITNSIVQDVTSLDSKNFHVHVLNGKNLTFDRFMITAPGDSVNTDGIHIGLSNEINIINSNITTDDDCISIGGASEQIRITNVRCGHGHGISMGSL RKTTDQFASRIFIRNCTFNDTDNGVRIKTWPALHGGIASDMHFEDIMMKN |
Full Sequence |
---|
Protein Sequence Length: 151 Download |
SLRFDFITNS IVQDVTSLDS KNFHVHVLNG KNLTFDRFMI TAPGDSVNTD GIHIGLSNEI 60 NIINSNITTD DDCISIGGAS EQIRITNVRC GHGHGISMGS LRKTTDQFAS RIFIRNCTFN 120 DTDNGVRIKT WPALHGGIAS DMHFEDIMMK N |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02218 | PLN02218 | 3.0e-23 | 1 | 151 | 152 | + polygalacturonase ADPG | ||
PLN03010 | PLN03010 | 3.0e-24 | 9 | 151 | 144 | + polygalacturonase | ||
PLN02793 | PLN02793 | 2.0e-28 | 12 | 151 | 141 | + Probable polygalacturonase | ||
PLN02188 | PLN02188 | 1.0e-39 | 1 | 151 | 155 | + polygalacturonase/glycoside hydrolase family protein | ||
pfam00295 | Glyco_hydro_28 | 1.0e-44 | 1 | 151 | 152 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAA89476.1 | 0 | 2 | 151 | 149 | 299 | polygalacturonase [Salix gilgiana] |
DDBJ | BAA89477.1 | 0 | 2 | 151 | 149 | 299 | polygalacturonase [Salix gilgiana] |
DDBJ | BAA89478.1 | 0 | 2 | 151 | 149 | 299 | polygalacturonase [Salix gilgiana] |
RefSeq | XP_002329175.1 | 0 | 2 | 151 | 149 | 299 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002333303.1 | 0 | 2 | 151 | 149 | 299 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1bhe_A | 0.0000000002 | 9 | 151 | 161 | 303 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
PDB | 2iq7_G | 0.0000000002 | 35 | 151 | 137 | 254 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 2iq7_F | 0.0000000002 | 35 | 151 | 137 | 254 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 2iq7_E | 0.0000000002 | 35 | 151 | 137 | 254 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 2iq7_D | 0.0000000002 | 35 | 151 | 137 | 254 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
homogalacturonan degradation | RXN-2103 | EC-3.2.1.15 | polygalacturonase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GW611463 | 151 | 2 | 151 | 0 |
GD088686 | 151 | 2 | 151 | 0 |
GO513613 | 153 | 1 | 151 | 0 |
EE255351 | 151 | 2 | 151 | 0 |
FC885548 | 151 | 2 | 151 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|