| Basic Information | |
|---|---|
| Species | Manihot esculenta |
| Cazyme ID | cassava4.1_030081m |
| Family | GH1 |
| Protein Properties | Length: 138 Molecular Weight: 16388.8 Isoelectric Point: 6.89 |
| Chromosome | Chromosome/Scaffold: 08302 Start: 62935 End: 63519 |
| Description | beta glucosidase 17 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 2 | 125 | 0 |
| DCSWLYIYPEGLYKLLLYLKRKYNHPVIYITENGMGDRSSLSVAEALEDKLRIKYHHLHLLSVLEAIKEGVDVKGYYIWSFLDDFEWDLGYTIRFGITYI DYTNELKRHLKHSALWFKKFLHEE | |||
| Full Sequence |
|---|
| Protein Sequence Length: 138 Download |
| TDCSWLYIYP EGLYKLLLYL KRKYNHPVIY ITENGMGDRS SLSVAEALED KLRIKYHHLH 60 LLSVLEAIKE GVDVKGYYIW SFLDDFEWDL GYTIRFGITY IDYTNELKRH LKHSALWFKK 120 FLHEENRTIA SSLLYSE* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR01233 | lacG | 5.0e-20 | 1 | 119 | 120 | + 6-phospho-beta-galactosidase. This enzyme is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
| COG2723 | BglB | 2.0e-28 | 8 | 120 | 113 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PRK13511 | PRK13511 | 7.0e-30 | 1 | 120 | 121 | + 6-phospho-beta-galactosidase; Provisional | ||
| TIGR03356 | BGL | 2.0e-30 | 1 | 118 | 118 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 2.0e-33 | 1 | 121 | 121 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI24822.1 | 0 | 1 | 122 | 5 | 128 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI24931.1 | 0 | 1 | 124 | 381 | 506 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002273684.1 | 1.4013e-45 | 1 | 125 | 381 | 507 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002276844.1 | 4.2039e-45 | 1 | 124 | 310 | 435 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002520637.1 | 0 | 1 | 137 | 383 | 519 | beta-glucosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 1.99965e-42 | 3 | 122 | 382 | 503 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptq_A | 1.99965e-42 | 3 | 122 | 382 | 503 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptm_B | 1.99965e-42 | 3 | 122 | 382 | 503 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptm_A | 1.99965e-42 | 3 | 122 | 382 | 503 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptk_B | 1.99965e-42 | 3 | 122 | 382 | 503 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FN708874 | 124 | 1 | 122 | 1.4013e-45 |
| FR625980 | 124 | 1 | 122 | 5.60519e-45 |
| FP048963 | 124 | 1 | 122 | 8.40779e-45 |
| FR634979 | 124 | 1 | 122 | 2.94273e-44 |
| FP045550 | 124 | 1 | 122 | 9.94922e-44 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |