y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_030609m
FamilyCE8
Protein PropertiesLength: 225 Molecular Weight: 24636 Isoelectric Point: 6.4961
ChromosomeChromosome/Scaffold: 09570 Start: 49462 End: 51790
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8612130
  ITVARHSFADFQTITGAIHSITVDNKQRIIIWINGGEYWEKITINSSKPFITFYGDPGDMPKIVFNGTAAQYGTVYSAIVAVESDYFMAANVAFVNRSTG
  SSMRISGDKAAFHNCQLVGFQDTLCDDRGRHLFKDCYFCGTVDFIFGNGKSLY
Full Sequence
Protein Sequence     Length: 225     Download
LLPLQLLPTA VSNSKQVPSD FTKLSSWVAD NIKDYNQRKA DASKGIPPIC LATAEDSVTV    60
ITVARHSFAD FQTITGAIHS ITVDNKQRII IWINGGEYWE KITINSSKPF ITFYGDPGDM    120
PKIVFNGTAA QYGTVYSAIV AVESDYFMAA NVAFVNRSTG SSMRISGDKA AFHNCQLVGF    180
QDTLCDDRGR HLFKDCYFCG TVDFIFGNGK SLYPVIFLQD SPCT*                    240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02671PLN026712.0e-3660213174+
PLN02634PLN026342.0e-3958213173+
PLN02682PLN026823.0e-4260213172+
PLN02304PLN023048.0e-4341213184+
PLN02665PLN026652.0e-1121213223+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27759.10621937264unnamed protein product [Vitis vinifera]
EMBLCBI38547.10121313231unnamed protein product [Vitis vinifera]
RefSeqXP_002277518.10621925252PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002326144.10121315241predicted protein [Populus trichocarpa]
RefSeqXP_002516214.10121317245Pectinesterase-3 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A9e-19612209169A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A0.0000000000003632137163B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1qjv_B0.000000000057121318185A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A0.000000000057121318185A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B0.000000000057121318185A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BI93537422412130
GO504417207172130
FC884230215172210
DY304101219172250
FC896493207172130
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00441.1Aquca_007_00353.1Aquca_001_00227.1Aquca_013_00738.1Aquca_025_00035.1
Aquca_054_00116.1Aquca_019_00164.1Aquca_009_01081.1Aquca_013_00738.2Aquca_010_00518.1
Aquca_076_00020.1Aquca_076_00019.1Aquca_002_00695.2Aquca_019_00164.2Aquca_002_00695.1
Aquca_002_00695.3Aquca_029_00012.1Aquca_015_00128.1Aquca_003_00510.1
Arabidopsis lyrata488866494222878699482653495646
320010902790905199487574325356
358371479173487573862304873977
892826480819892828489513
Arabidopsis thalianaAT5G19730.1AT5G47500.1AT1G05310.1AT5G55590.1AT2G36710.1
AT2G21610.1AT2G36700.1AT3G29090.1AT5G07410.1AT1G69940.1
AT5G07430.1AT5G61680.1AT3G17060.1AT5G07420.1AT3G24130.1
AT5G18990.1AT2G47280.1AT2G19150.1AT5G26810.1
Brachypodium distachyonBradi2g49500.1Bradi1g21810.1Bradi5g17850.1Bradi4g04620.1Bradi3g17880.1
Bradi4g38840.1Bradi4g09910.1Bradi3g24750.1Bradi2g44500.1Bradi4g00840.1
Bradi1g64340.1Bradi2g11470.1Bradi2g19420.1Bradi1g19360.1
Brassica rapaBra002257Bra020059Bra024939Bra022135Bra032469
Bra035579Bra005252Bra031204Bra005248Bra025376
Bra028699Bra033083Bra012932Bra009264Bra040910
Bra009265Bra036219Bra030289Bra005934Bra028698
Bra001652Bra022194Bra002891.216.401Bra002891.216.401Bra020099
Bra001928Bra028358Bra009921Bra038160Bra027892
Carica papayaevm.model.supercontig_145.20evm.model.supercontig_860.2evm.model.supercontig_29.158evm.model.supercontig_12.174evm.model.supercontig_82.70
evm.model.supercontig_5.133evm.model.supercontig_3.25evm.model.supercontig_14.109evm.model.supercontig_82.68evm.model.supercontig_8.283
evm.model.supercontig_3.28evm.model.supercontig_1973.3evm.model.supercontig_3.26evm.model.supercontig_59.133evm.model.supercontig_48.170
evm.model.supercontig_48.169
Capsella rubellaCarubv10001159mCarubv10026646mCarubv10028546mCarubv10023328mCarubv10006308m
Carubv10025460mCarubv10007965mCarubv10025126mCarubv10026738mCarubv10003776m
Carubv10023489mCarubv10003415mCarubv10017664mCarubv10015726mCarubv10003407m
Carubv10021951mCarubv10003190mCarubv10016365mCarubv10021607mCarubv10021724m
Carubv10003078mCarubv10011085m
Citrus clementinaCiclev10027321mCiclev10024027mCiclev10010616mCiclev10010593mCiclev10020787m
Ciclev10011953mCiclev10010655mCiclev10013444mCiclev10029966mCiclev10006909m
Ciclev10030015mCiclev10029855mCiclev10031872mCiclev10030026mCiclev10012239m
Ciclev10030318mCiclev10012403mCiclev10024124mCiclev10007120mCiclev10003837m
Ciclev10021167m.157.314Ciclev10021167m.157.314
Citrus sinensisorange1.1g019696morange1.1g043630morange1.1g018249morange1.1g016757morange1.1g047018m
orange1.1g039329morange1.1g046043morange1.1g042845morange1.1g038331morange1.1g039631m
orange1.1g021162morange1.1g046674morange1.1g039481morange1.1g021844morange1.1g024928m
orange1.1g043974morange1.1g038332morange1.1g036280morange1.1g044741morange1.1g043115m
orange1.1g039887m
Cucumis sativusCucsa.288760.2Cucsa.128610.1Cucsa.201150.1Cucsa.142040.1Cucsa.390850.1
Cucsa.301820.1Cucsa.288760.1Cucsa.378940.1Cucsa.232060.1Cucsa.109560.1
Cucsa.252510.1Cucsa.158110.1Cucsa.180130.1Cucsa.086770.1Cucsa.086750.1
Cucsa.086760.1Cucsa.086780.1Cucsa.158110.2.116.272Cucsa.158110.2.116.272Cucsa.193880.1
Cucsa.300590.1
Eucalyptus grandisEucgr.H00909.1Eucgr.E00425.1Eucgr.F03696.1Eucgr.H00909.2Eucgr.H04905.1
Eucgr.G01685.1Eucgr.F01579.1Eucgr.F01580.1Eucgr.C03721.1Eucgr.K00113.1
Eucgr.G02070.1Eucgr.H04048.1Eucgr.C02449.1Eucgr.H03295.1Eucgr.H03297.1
Eucgr.J02397.1Eucgr.H02786.1Eucgr.L00260.1Eucgr.H00056.1Eucgr.H03296.1
Eucgr.L00259.1Eucgr.C02448.1Eucgr.L00258.1Eucgr.B01686.1Eucgr.L00257.1.167.347
Eucgr.L00257.1.167.347Eucgr.F01581.1
Fragaria vescamrna11323.1-v1.0-hybridmrna12930.1-v1.0-hybridmrna23525.1-v1.0-hybridmrna24220.1-v1.0-hybridmrna08938.1-v1.0-hybrid
mrna00093.1-v1.0-hybridmrna30193.1-v1.0-hybridmrna05106.1-v1.0-hybridmrna04412.1-v1.0-hybridmrna11394.1-v1.0-hybrid
mrna21405.1-v1.0-hybridmrna24221.1-v1.0-hybridmrna15140.1-v1.0-hybridmrna31599.1-v1.0-hybridmrna05650.1-v1.0-hybrid.648.931
mrna05650.1-v1.0-hybrid.648.931mrna05650.1-v1.0-hybrid.648.931mrna05650.1-v1.0-hybrid.648.931mrna20388.1-v1.0-hybridmrna00138.1-v1.0-hybrid
mrna05650.1-v1.0-hybrid.325.608mrna05650.1-v1.0-hybrid.325.608mrna05650.1-v1.0-hybrid.325.608mrna05650.1-v1.0-hybrid.325.608mrna09634.1-v1.0-hybrid
mrna05650.1-v1.0-hybrid.125.274mrna05650.1-v1.0-hybrid.125.274mrna05650.1-v1.0-hybrid.125.274mrna05650.1-v1.0-hybrid.125.274
Glycine maxGlyma01g01010.1Glyma05g35930.1Glyma08g03700.1Glyma07g14930.2Glyma11g03560.1
Glyma01g41820.1Glyma17g15070.1Glyma19g32760.1Glyma01g01010.2Glyma14g01820.1
Glyma19g37180.1Glyma02g46890.1Glyma13g17390.3Glyma13g17390.2Glyma09g03960.1
Glyma14g01830.1Glyma09g36950.2Glyma09g36950.1Glyma02g46880.2Glyma18g49740.2
Glyma18g49740.1Glyma02g13820.1Glyma13g05650.1Glyma01g08730.1Glyma01g08690.1
Glyma01g08760.1Glyma01g09350.1Glyma19g03050.2Glyma16g09471.1Glyma02g09540.2
Glyma14g02385.1Glyma10g28753.1Glyma02g46400.2Glyma07g27450.2Glyma09g00620.2
Glyma04g33861.1
Gossypium raimondiiGorai.008G137400.1Gorai.008G064400.2Gorai.008G064400.1Gorai.010G077800.1Gorai.001G009400.1
Gorai.002G098600.1Gorai.013G154000.1Gorai.001G093600.1Gorai.003G171400.1Gorai.008G064400.3
Gorai.008G235300.1Gorai.006G160500.1Gorai.001G009400.2Gorai.005G244300.1Gorai.003G171400.2
Gorai.001G130900.1Gorai.009G201000.1Gorai.013G154000.2Gorai.009G272500.1Gorai.009G272700.1
Gorai.002G030400.1Gorai.006G014000.1Gorai.008G212700.1Gorai.008G213000.1Gorai.003G110300.1
Gorai.008G212500.1Gorai.003G110500.1Gorai.008G138100.1Gorai.006G014000.2Gorai.N023200.1
Gorai.008G212700.2Gorai.008G212900.1Gorai.008G213000.2Gorai.008G212600.1Gorai.008G212800.1
Gorai.013G207800.1Gorai.006G222300.1Gorai.013G129900.1
Linum usitatissimumLus10009997Lus10012942Lus10011132Lus10028364Lus10041815
Lus10043035Lus10010470Lus10004720Lus10016605Lus10027737
Lus10034893Lus10026347Lus10041699Lus10040541Lus10026047
Lus10014338Lus10023560Lus10037774Lus10042315Lus10024050
Lus10016711Lus10007113Lus10016678Lus10031421Lus10007136
Lus10000935Lus10000936Lus10010912.37.279Lus10010912.37.279Lus10010912.283.530
Lus10010912.283.530Lus10035553
Malus domesticaMDP0000218868MDP0000177299MDP0000212502MDP0000146743MDP0000306862
MDP0000172708MDP0000474161MDP0000936886MDP0000278119MDP0000181239
MDP0000528429MDP0000857958MDP0000195096MDP0000123530MDP0000768667
MDP0000446321MDP0000219907MDP0000870113MDP0000278118MDP0000184228
MDP0000376664MDP0000549344MDP0000401070MDP0000252508MDP0000251256
MDP0000287234MDP0000258116MDP0000174692MDP0000206503MDP0000556230
MDP0000471558MDP0000135450
Manihot esculentacassava4.1_009618mcassava4.1_009702mcassava4.1_010249mcassava4.1_033379mcassava4.1_010240m
cassava4.1_026309mcassava4.1_010674mcassava4.1_032721mcassava4.1_021555mcassava4.1_022331m
cassava4.1_030595mcassava4.1_030890mcassava4.1_027193mcassava4.1_030436mcassava4.1_032503m
cassava4.1_026722mcassava4.1_032455mcassava4.1_029613mcassava4.1_020917mcassava4.1_032261m
cassava4.1_033437mcassava4.1_030641mcassava4.1_023733m.346.625cassava4.1_023733m.346.625cassava4.1_021727m
cassava4.1_031624mcassava4.1_028252mcassava4.1_026328mcassava4.1_023733m.29.316cassava4.1_023733m.29.316
cassava4.1_029633mcassava4.1_033247mcassava4.1_027197mcassava4.1_022956mcassava4.1_032034m
Medicago truncatulaMedtr8g102380.1Medtr5g012600.1Medtr5g095490.1Medtr7g092780.1Medtr1g086540.1
Medtr7g102600.1Medtr4g124740.1Medtr7g011530.1Medtr6g012800.1Medtr2g033970.1
Medtr5g088300.1Medtr5g088280.1Medtr5g088290.1Medtr4g051810.1Medtr5g093970.1
Medtr6g042690.1Medtr6g042660.1.176.362Medtr6g042660.1.176.362Medtr1g039640.1Medtr6g025590.1
Medtr4g130790.1
Mimulus guttatusmgv1a008262mmgv1a019910mmgv1a024695mmgv1a025960mmgv1a011822m
mgv1a022744mmgv1a008469mmgv1a008712mmgv1a007131mmgv1a018528m
mgv1a025315mmgv1a010310mmgv1a009526mmgv1a023562mmgv1a024891m
mgv1a008641mmgv1a011615mmgv1a025297mmgv1a021664m
Oryza sativaLOC_Os01g53990.1LOC_Os05g44600.1LOC_Os07g41650.1LOC_Os04g46740.1LOC_Os08g10604.1
LOC_Os12g37660.1LOC_Os11g45730.1LOC_Os01g53990.2LOC_Os11g45720.1LOC_Os09g39760.1
LOC_Os07g41650.2LOC_Os01g44340.1LOC_Os10g26680.1LOC_Os10g26680.2LOC_Os04g46740.2
LOC_Os03g19610.1LOC_Os01g19440.1LOC_Os07g46190.1LOC_Os11g43830.1
Panicum virgatumPavirv00013899mPavirv00048215mPavirv00050807mPavirv00024525mPavirv00040591m
Pavirv00051839mPavirv00005854mPavirv00036597mPavirv00029328mPavirv00035711m
Pavirv00007521mPavirv00063328mPavirv00016861mPavirv00044964mPavirv00028804m
Pavirv00052282mPavirv00001796mPavirv00038911mPavirv00046994mPavirv00038832m
Pavirv00010445mPavirv00046526mPavirv00070844mPavirv00006056mPavirv00059330m
Pavirv00050930mPavirv00020445m.93.240Pavirv00020445m.93.240Pavirv00040986mPavirv00060860m
Physcomitrella patensPp1s55_167V6.3Pp1s55_167V6.2Pp1s55_167V6.1Pp1s23_141V6.1Pp1s118_31V6.1
Pp1s67_89V6.4Pp1s67_89V6.3Pp1s67_89V6.2Pp1s67_89V6.1Pp1s45_249V6.1
Pp1s112_175V6.1Pp1s3_508V6.1Pp1s35_88V6.1Pp1s59_288V6.1Pp1s112_177V6.1
Pp1s175_19V6.1Pp1s215_36V6.1Pp1s198_26V6.1Pp1s35_24V6.1Pp1s81_236V6.1
Pp1s236_87V6.1Pp1s236_80V6.1Pp1s446_3V6.2Pp1s461_15V6.1Pp1s236_72V6.1
Pp1s227_9V6.1Pp1s67_157V6.1Pp1s67_6V6.1Pp1s129_155V6.1Pp1s341_66V6.1
Pp1s215_36V6.2Pp1s112_158V6.1Pp1s325_49V6.1Pp1s118_55V6.1Pp1s35_51V6.1
Pp1s236_72V6.2Pp1s14_353V6.1Pp1s215_36V6.3Pp1s446_3V6.1.92.256Pp1s446_3V6.1.92.256
Pp1s23_141V6.2
Phaseolus vulgarisPhvul.007G212000.1Phvul.004G175200.1Phvul.002G308000.1Phvul.002G063100.1Phvul.003G220500.1
Phvul.001G140600.1Phvul.001G183100.1Phvul.008G278000.2Phvul.008G278000.1Phvul.008G277900.1
Phvul.003G127700.1Phvul.008G039000.1Phvul.003G027000.1Phvul.008G271800.1Phvul.008G272000.1
Phvul.003G015600.1Phvul.008G271500.1Phvul.008G271600.1Phvul.003G015700.1Phvul.007G202000.1
Phvul.007G201900.1
Picea abiesMA_10428610g0010MA_14449g0010MA_20853g0010MA_28575g0010MA_181657g0020
MA_99816g0010MA_66089g0010MA_304854g0010MA_18312g0010MA_62865g0010
MA_6149868g0010MA_87592g0010MA_274107g0010MA_10267810g0010MA_10428610g0020
MA_112715g0010MA_40503g0010MA_101720g0010MA_6780346g0010MA_10434773g0030
MA_10428625g0010MA_10426622g0010MA_5097g0010MA_33008g0010MA_16389g0020
MA_19196g0010MA_98283g0010MA_10434773g0010
Populus trichocarpaPotri.018G068400.1Potri.014G117100.1Potri.007G015700.2Potri.007G015700.1Potri.003G076900.2
Potri.003G076900.1Potri.001G365700.1Potri.001G364200.1Potri.016G017700.1Potri.018G068400.3
Potri.006G120100.1Potri.004G156300.1Potri.006G137100.1Potri.003G076900.3Potri.003G076900.4
Potri.015G110700.1Potri.006G186100.1Potri.006G186000.1Potri.008G104800.1Potri.012G114900.1
Potri.012G112800.1Potri.T007200.1Potri.004G128900.1Potri.006G120100.2Potri.004G128900.2
Potri.004G128900.3Potri.017G087300.1Potri.005G012800.1Potri.018G068400.2Potri.012G115200.1
Potri.017G054700.1Potri.013G008100.1Potri.004G033700.1Potri.001G314600.1
Prunus persicappa007112mppa005976mppa023424mppa006779mppa023784m
ppa024139mppa007761mppa025119mppa027083mppa026550m
ppa021246mppa022374mppa017141mppa015611mppa007766m
ppa018812mppa007533mppa015184mppa019696mppa008873m
ppa026195mppb020245mppa020130mppa024066mppa017319m
ppa020682mppa019869mppa019999mppa024542mppa019857m
ppb015196mppb012738m
Ricinus communis28623.m00038929912.m00542629629.m00135630106.m00067729739.m003697
30131.m00704729916.m00052230147.m01436230078.m00222230147.m014363
29748.m00038029635.m00045228859.m00033030147.m01436130076.m004631.364.651
30076.m004631.364.65130147.m01436030076.m004631.38.33030076.m004631.38.33030071.m000430
30128.m00891929904.m00295430076.m004627
Setaria italicaSi004863mSi022230mSi030204mSi012719mSi024215m
Si015123mSi027980mSi039580mSi004149mSi036641m
Si019219mSi006799mSi004903mSi032068mSi005070m
Si004867mSi019694m
Selaginella moellendorffii101090769516566316509876693
104861815833494273566402675
16420210330577752
Sorghum bicolorSb09g026060.1Sb03g034250.1Sb06g024730.1Sb08g018360.1Sb07g006050.1
Sb02g012560.1Sb05g026816.1Sb04g031450.1Sb02g038910.1Sb01g022290.1
Sb03g028930.1Sb03g022950.1Sb03g012410.1Sb02g041430.1Sb02g041430.2
Sb04g037730.1
Thellungiella halophilaThhalv10013810mThhalv10000935mThhalv10009800mThhalv10013811mThhalv10015978m
Thhalv10000702mThhalv10005724mThhalv10004453mThhalv10013913mThhalv10013901m
Thhalv10021065mThhalv10023834mThhalv10002927mThhalv10001795mThhalv10029493m
Thhalv10005316m
Vitis viniferaGSVIVT01028170001GSVIVT01018823001GSVIVT01015290001GSVIVT01001327001GSVIVT01015852001
GSVIVT01033712001GSVIVT01015022001GSVIVT01014641001GSVIVT01009729001GSVIVT01023786001
GSVIVT01013838001GSVIVT01013839001GSVIVT01013827001GSVIVT01013832001GSVIVT01034985001
GSVIVT01011459001GSVIVT01000525001GSVIVT01031250001.248.534GSVIVT01031250001.248.534GSVIVT01031250001.56.207
GSVIVT01031250001.56.207
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)