CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_031145m
FamilyAA2
Protein PropertiesLength: 341 Molecular Weight: 37695.2 Isoelectric Point: 8.5276
ChromosomeChromosome/Scaffold: 05280 Start: 192092 End: 193917
DescriptionPeroxidase superfamily protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2643212.8026e-45
  WKQDKSITPKLLRLLYSDCFVTGCDASILLDGPNSEKTAPQNRGLGGFALIDKIKQVLEQRCPGVVSCADILNLATRDAVHLAGAPSYPVYTGRRDGMSS
  SSASVDLPSPSIPLSKALAYFKSKGLDVLDFATLLGAHSLGKTHCSFVEDRLYNFGNTGKPDPNMDPAFAAEMRKLCPPRTKKGQSDPLVFLNPESGSNY
  KFTETFYQGVLSYKSVLGVDQQLLFSNDTLDITQEFAANFEDMRRSFALSMNRMGNID
Full Sequence
Protein Sequence     Length: 341     Download
MRKTESVMTF SPLVVLALSL FTIAIVEAAV TLQPPVKLQW QYYKRNTSCP DAEVYIRHQI    60
EQYWKQDKSI TPKLLRLLYS DCFVTGCDAS ILLDGPNSEK TAPQNRGLGG FALIDKIKQV    120
LEQRCPGVVS CADILNLATR DAVHLAGAPS YPVYTGRRDG MSSSSASVDL PSPSIPLSKA    180
LAYFKSKGLD VLDFATLLGA HSLGKTHCSF VEDRLYNFGN TGKPDPNMDP AFAAEMRKLC    240
PPRTKKGQSD PLVFLNPESG SNYKFTETFY QGVLSYKSVL GVDQQLLFSN DTLDITQEFA    300
ANFEDMRRSF ALSMNRMGNI DVLTGYAGEI RRNCRVVNKK * 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase0.00248207176+
cd00314plant_peroxidase_like6.0e-1856319282+
pfam00141peroxidase1.0e-4956202149+
PLN03030PLN030301.0e-728338342+
cd00693secretory_peroxidase3.0e-13437337305+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PIR0133381325UP10_LACSN Unknown protein 10 from 2D-PAGE
EMBLCAN61767.10133825363hypothetical protein [Vitis vinifera]
RefSeqNP_197795.1083384335peroxidase family protein [Arabidopsis thaliana]
RefSeqXP_002272039.1013381339PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310424.1013381336predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0363381304A Chain A, Structure Of Native Leukotriene A4 Hydrolase From Saccharomyces Cerevisiae
PDB1pa2_A0363381304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1qgj_B04833910300A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A04833910300A Chain A, Arabidopsis Thaliana Peroxidase N
PDB4a5g_B04833812305A Chain A, Raphanus Sativus Anionic Peroxidase.
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX28075429122920
DV131529245803240
EX26010728222830
GE347064256372910
JZ012912267733380
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_028_00270.1
Arabidopsis lyrata488648489264483456913963354185
477612489097
Arabidopsis thalianaAT5G22410.1AT5G17820.1AT2G43480.1AT5G24070.1AT3G03670.1
AT4G26010.1AT1G34510.1
Brachypodium distachyonBradi3g33780.1Bradi3g10460.1Bradi3g10470.1
Brassica rapaBra006423Bra023639Bra036445Bra037713Bra009728
Bra026470Bra019132Bra013943Bra001084Bra019131
Bra020191
Carica papayaevm.model.supercontig_161.43evm.model.supercontig_1040.1evm.model.supercontig_13.208evm.model.supercontig_195.9
Capsella rubellaCarubv10003382mCarubv10003258mCarubv10024496mCarubv10003419mCarubv10006454m
Carubv10006236mCarubv10016138m
Citrus clementinaCiclev10024589mCiclev10024189mCiclev10023906mCiclev10030190m
Citrus sinensisorange1.1g043363morange1.1g045265morange1.1g040171m
Cucumis sativusCucsa.362070.1Cucsa.319800.1
Eucalyptus grandisEucgr.A02147.1Eucgr.J00503.1Eucgr.B03840.1Eucgr.B03838.1Eucgr.A00301.1
Eucgr.A00298.1Eucgr.A00295.1Eucgr.A00045.1Eucgr.A00299.2Eucgr.A00299.1
Eucgr.A00042.1Eucgr.A02146.1Eucgr.D00818.1Eucgr.A00296.1
Fragaria vescamrna26378.1-v1.0-hybridmrna07700.1-v1.0-hybridmrna21725.1-v1.0-hybrid
Glycine maxGlyma03g01020.1Glyma03g01010.1Glyma13g42140.1Glyma15g03250.1Glyma19g16960.1
Gossypium raimondiiGorai.004G252800.1Gorai.009G084400.1Gorai.007G253300.1Gorai.005G126200.1
Linum usitatissimumLus10004859Lus10005679Lus10032511Lus10020312Lus10022962
Lus10004804Lus10025586Lus10013631Lus10001324Lus10005681
Lus10043010Lus10018375Lus10020311
Malus domesticaMDP0000269302MDP0000264903MDP0000243237MDP0000156208
Manihot esculentacassava4.1_024710mcassava4.1_028102mcassava4.1_022946m
Medicago truncatulaMedtr7g086820.1Medtr7g086870.1
Mimulus guttatusmgv1a010343mmgv1a024318mmgv1a022139m
Oryza sativaLOC_Os03g05770.1LOC_Os04g01550.1LOC_Os10g41720.1LOC_Os09g15510.1LOC_Os09g15500.1
Panicum virgatumPavirv00070122mPavirv00055443mPavirv00050601mPavirv00048315mPavirv00056057m
Pavirv00026792mPavirv00052815mPavirv00005617mPavirv00066198mPavirv00005755m
Pavirv00010656mPavirv00020133m
Physcomitrella patensPp1s112_99V6.1Pp1s35_32V6.1Pp1s12_174V6.1
Phaseolus vulgarisPhvul.005G154900.1Phvul.004G053800.1Phvul.001G106500.1Phvul.001G106600.1
Picea abiesMA_257706g0010MA_10426168g0010.52.319MA_10426168g0010.52.319MA_180710g0010MA_10293471g0010
MA_10428075g0010MA_63239g0010MA_10372670g0010MA_10426168g0010.347.524MA_10426168g0010.347.524
Populus trichocarpaPotri.001G218500.1Potri.001G218600.1Potri.013G066800.1Potri.015G110200.1Potri.007G132800.1
Prunus persicappa023274mppa026551mppa009513m
Ricinus communis30072.m00092829272.m00004330147.m014371
Setaria italicaSi011748mSi036621mSi036586mSi036567mSi038861m
Si039188m
Selaginella moellendorffii416327
Sorghum bicolorSb06g000490.1Sb01g046800.1Sb01g028640.1Sb01g016620.1Sb01g028610.1
Thellungiella halophilaThhalv10015253mThhalv10014171mThhalv10004528mThhalv10001541mThhalv10025781m
Thhalv10021155mThhalv10026803m
Vitis viniferaGSVIVT01004097001GSVIVT01036100001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)