CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_031147m
FamilyGH1
Protein PropertiesLength: 483 Molecular Weight: 55058.7 Isoelectric Point: 6.2756
ChromosomeChromosome/Scaffold: 03332 Start: 1098915 End: 1101836
Descriptionbeta glucosidase 46
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1284740
  RSHFPPSFLFGTATSSYQIEGAYLEDKKGLSNWDVFTHLYSGKIADGSNGDVADDHYHLFLDDIELMHSLGVNSYRFSISWARILPQGRFGEVNQEGIAF
  YNKLIDALLIKGIEPVVTLQHFDVPQELEDRYGAWLNSQIQDDFGYFADICFEAFGDRVKYWITLNEANMVAQYCYYSGIWPPNRCSYPAGKCKAGNSDL
  EPYIAAHNMILAHAIATDIYRKKYQEKQGGKIGIVLHIYWYEPLRDIPADRVAAQRALAFIAAWFMDPIMFGEYPPEMQQIVGLRLPAFSAEDKRKLANK
  LDFIGINHYSTLYAKDCLLTPCNYHDDLLKDTFIYGTGEKDGILIGDPTLGKYTRLAGYAQPSSKKIEDMLNDTSRVEYMEGYLTSLISAIRNGADVRGY
  FHWSLIDNFEWTYGYTISFGLYHVDRTTMQRTPKRSAKWFQQFLKNK
Full Sequence
Protein Sequence     Length: 483     Download
MKKSCFALVP FLSAILLLII DRCSCLDRSH FPPSFLFGTA TSSYQIEGAY LEDKKGLSNW    60
DVFTHLYSGK IADGSNGDVA DDHYHLFLDD IELMHSLGVN SYRFSISWAR ILPQGRFGEV    120
NQEGIAFYNK LIDALLIKGI EPVVTLQHFD VPQELEDRYG AWLNSQIQDD FGYFADICFE    180
AFGDRVKYWI TLNEANMVAQ YCYYSGIWPP NRCSYPAGKC KAGNSDLEPY IAAHNMILAH    240
AIATDIYRKK YQEKQGGKIG IVLHIYWYEP LRDIPADRVA AQRALAFIAA WFMDPIMFGE    300
YPPEMQQIVG LRLPAFSAED KRKLANKLDF IGINHYSTLY AKDCLLTPCN YHDDLLKDTF    360
IYGTGEKDGI LIGDPTLGKY TRLAGYAQPS SKKIEDMLND TSRVEYMEGY LTSLISAIRN    420
GADVRGYFHW SLIDNFEWTY GYTISFGLYH VDRTTMQRTP KRSAKWFQQF LKNKSGVLHA    480
QE* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG2723BglB7.0e-13131469473+
PLN02849PLN028498.0e-13415481485+
PLN02814PLN028147.0e-13512472485+
TIGR03356BGL6.0e-14432467454+
pfam00232Glyco_hydro_13.0e-15431474469+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001140717.101147416507hypothetical protein LOC100272792 [Zea mays]
RefSeqNP_001148165.102847434506beta-glucosidase [Zea mays]
Swiss-ProtQ7XSK002647327500BGL18_ORYSJ RecName: Full=Beta-glucosidase 18; Short=Os4bglu18; Flags: Precursor
RefSeqXP_002448178.102347329505hypothetical protein SORBIDRAFT_06g022500 [Sorghum bicolor]
RefSeqXP_002448179.101647324511hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A02647212487A Chain A, Structure Of Apo Sucrose Phosphate Synthase (Sps) Of Halothermothrix Orenii
PDB3gnp_A02647212487A Chain A, Structure Of Apo Sucrose Phosphate Synthase (Sps) Of Halothermothrix Orenii
PDB3gno_A02647212487A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3scq_B02647315481A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3scq_A02647315481A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO840911307183230
GO873406331183470
JG567660266623270
GO864825299163120
FG552014260262850
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)