Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_031379m |
Family | CBM43 |
Protein Properties | Length: 119 Molecular Weight: 12666.5 Isoelectric Point: 4.8439 |
Chromosome | Chromosome/Scaffold: 02421 Start: 544289 End: 544743 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 32 | 113 | 1.1e-34 |
WCVARSDASNQALQTAIDYACSAGADCIPIQSNGLCFLPNTIQAHASYAFNSYFQRKAMAPGSCDFSGTATVAKTDPSYGSC |
Full Sequence |
---|
Protein Sequence Length: 119 Download |
MEALSKKLIF ILFVIIIILE TVTILPTAEG NWCVARSDAS NQALQTAIDY ACSAGADCIP 60 IQSNGLCFLP NTIQAHASYA FNSYFQRKAM APGSCDFSGT ATVAKTDPSY GSCVYPSSP 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-20 | 32 | 102 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 6.0e-37 | 32 | 115 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU17645.1 | 0 | 7 | 118 | 5 | 116 | unknown [Glycine max] |
RefSeq | NP_193096.5 | 0 | 32 | 118 | 61 | 147 | unknown protein [Arabidopsis thaliana] |
RefSeq | XP_002267551.1 | 0 | 28 | 118 | 44 | 136 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002323780.1 | 0 | 32 | 109 | 1 | 78 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002518089.1 | 0 | 12 | 118 | 7 | 113 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-28 | 21 | 117 | 2 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |