| Basic Information | |
|---|---|
| Species | Manihot esculenta |
| Cazyme ID | cassava4.1_031401m |
| Family | AA2 |
| Protein Properties | Length: 187 Molecular Weight: 20704.3 Isoelectric Point: 8.8599 |
| Chromosome | Chromosome/Scaffold: 06512 Start: 994019 End: 995273 |
| Description | ascorbate peroxidase 3 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 1 | 99 | 1.6e-24 |
| WHDAGTYDAKTKTGGPNGSIRNEKEYNHEANRGLKLAIDLCEEIKAKHPKITYADLYQLAGVVAVERSLEDSTESAEEGRLPDAKKGASHLRDVFSRMG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 187 Download |
| WHDAGTYDAK TKTGGPNGSI RNEKEYNHEA NRGLKLAIDL CEEIKAKHPK ITYADLYQLA 60 GVVAVERSLE DSTESAEEGR LPDAKKGASH LRDVFSRMGK AHRERSGFEG AWTKEPLKFD 120 NSHFRSETYY PKLLKRDSEG LLKLPLGQDS EKLGFTPPSR AAKGTLLAQS AVGVAVAATV 180 VIFSYYY 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00314 | plant_peroxidase_like | 7.0e-23 | 1 | 161 | 205 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
| PLN02364 | PLN02364 | 5.0e-40 | 1 | 144 | 171 | + L-ascorbate peroxidase 1 | ||
| PLN02879 | PLN02879 | 7.0e-46 | 1 | 145 | 171 | + L-ascorbate peroxidase | ||
| cd00691 | ascorbate_peroxidase | 1.0e-67 | 1 | 145 | 178 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
| PLN02608 | PLN02608 | 6.0e-82 | 1 | 187 | 250 | + L-ascorbate peroxidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004601 | peroxidase activity |
| GO:0006979 | response to oxidative stress |
| GO:0020037 | heme binding |
| GO:0055114 | oxidation-reduction process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABA10744.1 | 0 | 1 | 187 | 39 | 280 | cytosolic ascorbate peroxidase isoform 4 [Solanum lycopersicum] |
| DDBJ | BAG09367.1 | 0 | 1 | 145 | 40 | 204 | peroxisomal ascorbate peroxidase [Glycine max] |
| EMBL | CAA06823.1 | 0 | 1 | 187 | 39 | 280 | ascorbate peroxidase [Arabidopsis thaliana] |
| RefSeq | NP_195226.1 | 0 | 1 | 187 | 39 | 280 | APX3 (ASCORBATE PEROXIDASE 3); L-ascorbate peroxidase [Arabidopsis thaliana] |
| RefSeq | XP_002327746.1 | 0 | 1 | 187 | 39 | 281 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1apx_D | 0 | 1 | 145 | 40 | 205 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_C | 0 | 1 | 145 | 40 | 205 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_B | 0 | 1 | 145 | 40 | 205 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 1apx_A | 0 | 1 | 145 | 40 | 205 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
| PDB | 2y6a_A | 1.4013e-45 | 1 | 145 | 40 | 205 | A Chain A, Ascorbate Peroxidase R38a Mutant |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| ascorbate glutathione cycle | RXN-3521 | - | L-ascorbate peroxidase |
| L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
| L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
