y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_031999m
FamilyGH9
Protein PropertiesLength: 269 Molecular Weight: 30000.7 Isoelectric Point: 6.8483
ChromosomeChromosome/Scaffold: 07859 Start: 230592 End: 231737
Descriptionglycosyl hydrolase 9A4
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH922430
  ADELMWAATWLYKATHNSVYLKYLTDEAINADVSEFSWDLKYAGANILLSKYFFKGKNGLTTHKKAADSFVCSVLPDSPFHQLYFTPGGMLHLRDGANTQ
  YVTGAALLFSVYSDILEDYKQKVTCGQKQFDSTALLKFAQQQMDYLLGKNPLNRSFMVGFGNNPPTQAHHRGASIPLNEAKDNVDCSKSFEWLHRKGPNP
  NELTGAFLGGPDKYDKFSDERTVSCMTEPCTYVNSQAVGVLA
Full Sequence
Protein Sequence     Length: 269     Download
MADELMWAAT WLYKATHNSV YLKYLTDEAI NADVSEFSWD LKYAGANILL SKYFFKGKNG    60
LTTHKKAADS FVCSVLPDSP FHQLYFTPGG MLHLRDGANT QYVTGAALLF SVYSDILEDY    120
KQKVTCGQKQ FDSTALLKFA QQQMDYLLGK NPLNRSFMVG FGNNPPTQAH HRGASIPLNE    180
AKDNVDCSKS FEWLHRKGPN PNELTGAFLG GPDKYDKFSD ERTVSCMTEP CTYVNSQAVG    240
VLARLASDSN QLMHKNEDAA SHQWHKSD*                                      300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02345PLN023459.0e-693250264+
PLN02340PLN023407.0e-702247258+
PLN02171PLN021711.0e-712247261+
PLN02613PLN026137.0e-793261263+
PLN02909PLN029091.0e-1393248247+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB83158.103247237482cellulase-like protein [Arabidopsis thaliana]
EMBLCAN82881.103246220464hypothetical protein [Vitis vinifera]
RefSeqXP_002280120.103246146390PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308519.103248221467predicted protein [Populus trichocarpa]
RefSeqXP_002516149.103247237482endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A4e-253247213430A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ksc_A4e-253247213430A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ks8_A4e-253247213430A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1ia7_A2e-211243209424A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB1ia6_A2e-211243209424A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT73590824932500
CX19204325432540
GR45968023732380
GW612799217322470
DK545386227242490
Orthologous Group
SpeciesID
Brassica rapaBra034983.281.436Bra034983.281.436
Manihot esculentacassava4.1_023731m
Picea abiesMA_54112g0010.200.457MA_54112g0010.200.457
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny