Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_033885m |
Family | CBM43 |
Protein Properties | Length: 115 Molecular Weight: 12715.7 Isoelectric Point: 7.9704 |
Chromosome | Chromosome/Scaffold: 03542 Start: 150274 End: 150915 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 31 | 111 | 1e-28 |
WCVAKPSSDQATLLANINYACSQVDCRILHKGCPCFSPDNLISHASIAMNLYYQCRGRNRWNCDFKNSALIVITDPSFADC |
Full Sequence |
---|
Protein Sequence Length: 115 Download |
MTKAAPLLLL FLYLISVGNL VASNNYEQKT WCVAKPSSDQ ATLLANINYA CSQVDCRILH 60 KGCPCFSPDN LISHASIAMN LYYQCRGRNR WNCDFKNSAL IVITDPSFAD CIYA* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-14 | 30 | 99 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-29 | 30 | 113 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_177973.4 | 8.40779e-45 | 8 | 113 | 10 | 114 | unknown protein [Arabidopsis thaliana] |
RefSeq | XP_002285661.1 | 0 | 15 | 114 | 17 | 114 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002300444.1 | 0 | 18 | 114 | 21 | 115 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002332529.1 | 0 | 3 | 114 | 11 | 120 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002528491.1 | 0 | 1 | 114 | 1 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 4e-24 | 30 | 113 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |