Basic Information | |
---|---|
Species | Carica papaya |
Cazyme ID | evm.TU.contig_28540.1 |
Family | GH35 |
Protein Properties | Length: 139 Molecular Weight: 16039.6 Isoelectric Point: 9.0371 |
Chromosome | Chromosome/Scaffold: 28540 Start: 97 End: 961 |
Description | beta-galactosidase 7 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH35 | 6 | 129 | 0 |
IIISGAIHYPRSTPQMWPDLIQKAKDGGLDAIETYIFWNIHEPRRRQYNFTGNLDFVKFFKLTHQAGLYGILRIGPYACAEWNFGGFPVWLKNMPGIELR TNNEIYKNEMKIFTTKIVNICKDA |
Full Sequence |
---|
Protein Sequence Length: 139 Download |
MVTTGIIISG AIHYPRSTPQ MWPDLIQKAK DGGLDAIETY IFWNIHEPRR RQYNFTGNLD 60 FVKFFKLTHQ AGLYGILRIG PYACAEWNFG GFPVWLKNMP GIELRTNNEI YKNEMKIFTT 120 KIVNICKDAI YLPHKEDL* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam02449 | Glyco_hydro_42 | 0.0002 | 13 | 96 | 85 | + Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues. |
COG1874 | LacA | 5.0e-16 | 6 | 123 | 129 | + Beta-galactosidase [Carbohydrate transport and metabolism] |
PLN03059 | PLN03059 | 3.0e-59 | 6 | 127 | 122 | + beta-galactosidase; Provisional |
pfam01301 | Glyco_hydro_35 | 5.0e-69 | 6 | 128 | 123 | + Glycosyl hydrolases family 35. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAJ09953.1 | 0 | 6 | 127 | 40 | 162 | beta-galactosidase [Mangifera indica] |
RefSeq | XP_002326135.1 | 0 | 6 | 129 | 45 | 168 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002516237.1 | 0 | 6 | 127 | 40 | 161 | beta-galactosidase, putative [Ricinus communis] |
RefSeq | XP_002516256.1 | 0 | 6 | 128 | 62 | 184 | beta-galactosidase, putative [Ricinus communis] |
RefSeq | XP_002528629.1 | 0 | 6 | 129 | 22 | 145 | beta-galactosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3d3a_A | 2e-25 | 6 | 128 | 23 | 145 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_D | 8e-25 | 8 | 111 | 28 | 131 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_C | 8e-25 | 8 | 111 | 28 | 131 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_B | 8e-25 | 8 | 111 | 28 | 131 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 3thd_A | 8e-25 | 8 | 111 | 28 | 131 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FC884172 | 124 | 6 | 129 | 0 |
DB962382 | 124 | 6 | 129 | 0 |
DB962174 | 124 | 6 | 129 | 0 |
FK000633 | 124 | 6 | 129 | 0 |
DY280097 | 124 | 6 | 129 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|