y
Basic Information | |
---|---|
Species | Carica papaya |
Cazyme ID | evm.TU.contig_29840.1 |
Family | GH17 |
Protein Properties | Length: 100 Molecular Weight: 11042.4 Isoelectric Point: 6.2494 |
Chromosome | Chromosome/Scaffold: 29840 Start: 2340 End: 2639 |
Description | beta-1,3-glucanase 2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH17 | 1 | 98 | 1.7e-37 |
MVEAVHSALEKVGGGSLEVVVTESGWPTAGDIGASFENAQTYNNNLIQHVKQGTPKKPGKPTETYLFAMFNERGKEPEVEKNWGLFFPNKEHKYPVNF |
Full Sequence |
---|
Protein Sequence Length: 100 Download |
MVEAVHSALE KVGGGSLEVV VTESGWPTAG DIGASFENAQ TYNNNLIQHV KQGTPKKPGK 60 PTETYLFAMF NERGKEPEVE KNWGLFFPNK EHKYPVNFF* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG5309 | COG5309 | 2.0e-6 | 9 | 86 | 81 | + Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] | ||
pfam00332 | Glyco_hydro_17 | 2.0e-43 | 1 | 98 | 99 | + Glycosyl hydrolases family 17. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAD04296.1 | 5.04467e-44 | 1 | 98 | 36 | 133 | basic extracellular beta-1,3-glucanase precursor [Vitis vinifera] |
EMBL | CAB91554.1 | 3.00018e-42 | 1 | 98 | 247 | 344 | beta 1-3 glucanase [Vitis vinifera] |
RefSeq | XP_002277511.1 | 1.99965e-42 | 1 | 98 | 247 | 344 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002323325.1 | 1.00053e-42 | 1 | 98 | 106 | 203 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002533898.1 | 2.99878e-43 | 1 | 98 | 159 | 256 | Glucan endo-1,3-beta-glucosidase, basic isoform precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3f55_D | 5e-40 | 2 | 98 | 219 | 315 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3f55_C | 5e-40 | 2 | 98 | 219 | 315 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3f55_B | 5e-40 | 2 | 98 | 219 | 315 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3f55_A | 5e-40 | 2 | 98 | 219 | 315 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3em5_D | 5e-40 | 2 | 98 | 219 | 315 | A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GH618811 | 98 | 1 | 98 | 6e-38 |
HS396360 | 98 | 1 | 98 | 5e-37 |
HS052082 | 98 | 1 | 98 | 1e-36 |
HS396420 | 97 | 2 | 98 | 4e-36 |
CV129721 | 98 | 1 | 98 | 5e-36 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|