Basic Information | |
---|---|
Species | Carica papaya |
Cazyme ID | evm.model.supercontig_1272.1 |
Family | CBM43 |
Protein Properties | Length: 87 Molecular Weight: 9597.88 Isoelectric Point: 7.0342 |
Chromosome | Chromosome/Scaffold: 1272 Start: 2593 End: 3020 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 83 | 4.1e-30 |
WCVAKPSSQDKPLLDNIAYVCDQVDCGILNKGGPCYLPNNYINHASVAMNLYYQAKGRNPWNCDFTKSGLITITDPSYGNC |
Full Sequence |
---|
Protein Sequence Length: 87 Download |
KTWCVAKPSS QDKPLLDNIA YVCDQVDCGI LNKGGPCYLP NNYINHASVA MNLYYQAKGR 60 NPWNCDFTKS GLITITDPSY GNCIYE* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-14 | 2 | 67 | 72 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 8.0e-31 | 2 | 85 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_177973.4 | 2e-36 | 1 | 86 | 30 | 115 | unknown protein [Arabidopsis thaliana] |
RefSeq | XP_002285661.1 | 2e-34 | 1 | 85 | 29 | 113 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002300444.1 | 5e-37 | 1 | 85 | 30 | 114 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002332529.1 | 7e-35 | 1 | 85 | 35 | 119 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002528491.1 | 6e-39 | 1 | 85 | 32 | 116 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 7e-25 | 2 | 85 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
AM904233 | 87 | 1 | 87 | 0 |
EL403617 | 85 | 1 | 85 | 5e-40 |
CU573702 | 87 | 1 | 87 | 7e-39 |
EH704398 | 85 | 1 | 85 | 2e-38 |
CU494024 | 87 | 1 | 87 | 2e-37 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|