Basic Information | |
---|---|
Species | Carica papaya |
Cazyme ID | evm.model.supercontig_14.93 |
Family | GT5 |
Protein Properties | Length: 124 Molecular Weight: 13681.9 Isoelectric Point: 8.4119 |
Chromosome | Chromosome/Scaffold: 14 Start: 1040036 End: 1041424 |
Description | starch synthase 2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT5 | 15 | 122 | 1.5e-27 |
IERVVIGGLGDVAGALPKALARRGHRVMVVAPRYGDYAEAQDSGVRKRYKVNGQDFEVAYFQAYIDGVDFVFMDTPMFRHLGSSIYGGSQLDILKRMVLF CKAAVEVT |
Full Sequence |
---|
Protein Sequence Length: 124 Download |
MDLYILILNL AYGLIERVVI GGLGDVAGAL PKALARRGHR VMVVAPRYGD YAEAQDSGVR 60 KRYKVNGQDF EVAYFQAYID GVDFVFMDTP MFRHLGSSIY GGSQLDILKR MVLFCKAAVE 120 VTQ* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG0297 | GlgA | 5.0e-10 | 21 | 121 | 107 | + Glycogen synthase [Carbohydrate transport and metabolism] | ||
PRK00654 | glgA | 4.0e-11 | 21 | 123 | 106 | + glycogen synthase; Provisional | ||
pfam08323 | Glyco_transf_5 | 2.0e-20 | 21 | 121 | 105 | + Starch synthase catalytic domain. | ||
cd03791 | GT1_Glycogen_synthase_DULL1_like | 8.0e-24 | 20 | 123 | 110 | + This family is most closely related to the GT1 family of glycosyltransferases. Glycogen synthase catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms. | ||
TIGR02095 | glgA | 1.0e-26 | 21 | 121 | 105 | + glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate [Energy metabolism, Biosynthesis and degradation of polysaccharides]. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAF13168.1 | 0 | 21 | 121 | 276 | 376 | AF173900_1 granule bound starch synthase II precursor [Manihot esculenta] |
GenBank | ABV25894.1 | 0 | 21 | 121 | 276 | 376 | starch synthase isoform II [Manihot esculenta] |
GenBank | ACL98481.1 | 0 | 21 | 121 | 317 | 417 | starch synthase IIa precursor [Lotus japonicus] |
EMBL | CBI22230.1 | 0 | 21 | 121 | 330 | 430 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002531856.1 | 0 | 21 | 121 | 279 | 379 | starch synthase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3vuf_A | 0.0000000000007 | 31 | 120 | 36 | 134 | A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii. |
PDB | 3vue_A | 0.0000000000007 | 31 | 120 | 36 | 134 | A Chain A, Crystal Structure Of Rice Granule Bound Starch Synthase I Catalytic Domain |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
starch biosynthesis | GLYCOGENSYN-RXN | EC-2.4.1.21 | starch synthase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EY885591 | 102 | 21 | 122 | 0 |
FG152023 | 102 | 20 | 121 | 0 |
ES814275 | 101 | 21 | 121 | 0 |
AW032562 | 102 | 21 | 122 | 0 |
FG140735 | 101 | 21 | 121 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|