| Basic Information | |
|---|---|
| Species | Carica papaya |
| Cazyme ID | evm.model.supercontig_26.291 |
| Family | CE16 |
| Protein Properties | Length: 161 Molecular Weight: 18491.4 Isoelectric Point: 5.9243 |
| Chromosome | Chromosome/Scaffold: 26 Start: 1890081 End: 1890669 |
| Description | SGNH hydrolase-type esterase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CE16 | 8 | 145 | 8.1e-21 |
| MKELYKLGARRLLYFGAPPIGCLPMQRTLGGGIERKCVENYNTMAKLFNSEVIAALERINGKNKESRMVYVDIYTPLLDMIQNPQEYGFEVWDKGCCGTG LVEVSFLCTEPNIFTCENASTYLFWDSYHPTERAYRII | |||
| Full Sequence |
|---|
| Protein Sequence Length: 161 Download |
| MVSWNWLMKE LYKLGARRLL YFGAPPIGCL PMQRTLGGGI ERKCVENYNT MAKLFNSEVI 60 AALERINGKN KESRMVYVDI YTPLLDMIQN PQEYGFEVWD KGCCGTGLVE VSFLCTEPNI 120 FTCENASTYL FWDSYHPTER AYRIIVDYLL QNAVNKIFTN * 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd01847 | Triacylglycerol_lipase_like | 7.0e-12 | 15 | 151 | 138 | + Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions. | ||
| COG3240 | COG3240 | 2.0e-15 | 9 | 150 | 142 | + Phospholipase/lecithinase/hemolysin [Lipid metabolism / General function prediction only] | ||
| cd01846 | fatty_acyltransferase_like | 2.0e-20 | 9 | 151 | 143 | + Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols. | ||
| PLN03156 | PLN03156 | 3.0e-46 | 8 | 156 | 151 | + GDSL esterase/lipase; Provisional | ||
| cd01837 | SGNH_plant_lipase_like | 2.0e-64 | 8 | 152 | 145 | + SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0006629 | lipid metabolic process |
| GO:0016788 | hydrolase activity, acting on ester bonds |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI19909.1 | 0 | 1 | 154 | 200 | 354 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI19911.1 | 0 | 1 | 158 | 133 | 290 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI19912.1 | 0 | 1 | 157 | 133 | 289 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002270631.1 | 0 | 1 | 157 | 202 | 358 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002279381.1 | 0 | 1 | 158 | 198 | 356 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3kvn_A | 0.01 | 8 | 148 | 181 | 311 | X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa |
| PDB | 3kvn_X | 0.01 | 8 | 148 | 181 | 311 | X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CV096367 | 157 | 2 | 158 | 0 |
| EC946450 | 155 | 1 | 154 | 0 |
| EC942587 | 155 | 1 | 154 | 0 |
| CV100115 | 158 | 1 | 158 | 0 |
| CV095311 | 158 | 1 | 158 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
