Basic Information | |
---|---|
Species | Carica papaya |
Cazyme ID | evm.model.supercontig_26.291 |
Family | CE16 |
Protein Properties | Length: 161 Molecular Weight: 18491.4 Isoelectric Point: 5.9243 |
Chromosome | Chromosome/Scaffold: 26 Start: 1890081 End: 1890669 |
Description | SGNH hydrolase-type esterase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE16 | 8 | 145 | 8.1e-21 |
MKELYKLGARRLLYFGAPPIGCLPMQRTLGGGIERKCVENYNTMAKLFNSEVIAALERINGKNKESRMVYVDIYTPLLDMIQNPQEYGFEVWDKGCCGTG LVEVSFLCTEPNIFTCENASTYLFWDSYHPTERAYRII |
Full Sequence |
---|
Protein Sequence Length: 161 Download |
MVSWNWLMKE LYKLGARRLL YFGAPPIGCL PMQRTLGGGI ERKCVENYNT MAKLFNSEVI 60 AALERINGKN KESRMVYVDI YTPLLDMIQN PQEYGFEVWD KGCCGTGLVE VSFLCTEPNI 120 FTCENASTYL FWDSYHPTER AYRIIVDYLL QNAVNKIFTN * |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
cd01847 | Triacylglycerol_lipase_like | 7.0e-12 | 15 | 151 | 138 | + Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions. |
COG3240 | COG3240 | 2.0e-15 | 9 | 150 | 142 | + Phospholipase/lecithinase/hemolysin [Lipid metabolism / General function prediction only] |
cd01846 | fatty_acyltransferase_like | 2.0e-20 | 9 | 151 | 143 | + Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols. |
PLN03156 | PLN03156 | 3.0e-46 | 8 | 156 | 151 | + GDSL esterase/lipase; Provisional |
cd01837 | SGNH_plant_lipase_like | 2.0e-64 | 8 | 152 | 145 | + SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0006629 | lipid metabolic process |
GO:0016788 | hydrolase activity, acting on ester bonds |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI19909.1 | 0 | 1 | 154 | 200 | 354 | unnamed protein product [Vitis vinifera] |
EMBL | CBI19911.1 | 0 | 1 | 158 | 133 | 290 | unnamed protein product [Vitis vinifera] |
EMBL | CBI19912.1 | 0 | 1 | 157 | 133 | 289 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002270631.1 | 0 | 1 | 157 | 202 | 358 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002279381.1 | 0 | 1 | 158 | 198 | 356 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3kvn_A | 0.01 | 8 | 148 | 181 | 311 | X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa |
PDB | 3kvn_X | 0.01 | 8 | 148 | 181 | 311 | X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CV096367 | 157 | 2 | 158 | 0 |
EC946450 | 155 | 1 | 154 | 0 |
EC942587 | 155 | 1 | 154 | 0 |
CV100115 | 158 | 1 | 158 | 0 |
CV095311 | 158 | 1 | 158 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |