| Basic Information | |
|---|---|
| Species | Carica papaya |
| Cazyme ID | evm.model.supercontig_27.199 |
| Family | GH17 |
| Protein Properties | Length: 124 Molecular Weight: 13306.8 Isoelectric Point: 6.6044 |
| Chromosome | Chromosome/Scaffold: 27 Start: 1985632 End: 1986099 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 30 | 120 | 2.5e-27 |
| IGVNWGTVSFLKLNPSTVLDLLKQNKIQKVKIFDADPTVLEALVGSGIEVMIGIPNEMLAPLSSSTVAADLWVRQNVSRYLVKGGVDISIF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 124 Download |
| MAAFFGFKAP FFCLMILLVL VSVQVSESAI GVNWGTVSFL KLNPSTVLDL LKQNKIQKVK 60 IFDADPTVLE ALVGSGIEVM IGIPNEMLAP LSSSTVAADL WVRQNVSRYL VKGGVDISIF 120 LFG* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-17 | 30 | 109 | 80 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABN08871.1 | 9e-34 | 25 | 123 | 2 | 100 | Glycoside hydrolase, family 17; X8 [Medicago truncatula] |
| EMBL | CAN82722.1 | 7e-38 | 25 | 123 | 1 | 99 | hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002271875.1 | 1e-37 | 27 | 123 | 36 | 132 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002329964.1 | 9.94922e-44 | 13 | 123 | 10 | 122 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002525026.1 | 2.8026e-45 | 6 | 123 | 3 | 119 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.000000003 | 30 | 109 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 0.00000002 | 45 | 106 | 17 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 0.00000002 | 45 | 106 | 17 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 0.00000002 | 45 | 106 | 17 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 0.00000002 | 45 | 106 | 17 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EX260773 | 123 | 1 | 123 | 0 |
| DV114461 | 110 | 8 | 117 | 2.00386e-43 |
| DT511825 | 92 | 29 | 120 | 2.00386e-43 |
| EV522526 | 118 | 6 | 123 | 2.99878e-43 |
| DV112970 | 110 | 8 | 117 | 3.9937e-43 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |