Basic Information | |
---|---|
Species | Carica papaya |
Cazyme ID | evm.model.supercontig_2750.1 |
Family | CBM43 |
Protein Properties | Length: 88 Molecular Weight: 9725.83 Isoelectric Point: 4.6844 |
Chromosome | Chromosome/Scaffold: 2750 Start: 3665 End: 4266 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 2 | 82 | 1.7e-32 |
ADEQTPDDELQMALDWACGRGGVDCRELQANKACFMPNTVRDHASYAFNSYYQKFKKNGATCYFNSAAMITDLDPSHGSCK |
Full Sequence |
---|
Protein Sequence Length: 88 Download |
MADEQTPDDE LQMALDWACG RGGVDCRELQ ANKACFMPNT VRDHASYAFN SYYQKFKKNG 60 ATCYFNSAAM ITDLDPSHGS CKYEAIP* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PHA02828 | PHA02828 | 0.006 | 36 | 76 | 41 | + putative transmembrane protein; Provisional | ||
pfam07983 | X8 | 3.0e-16 | 2 | 70 | 74 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-33 | 1 | 83 | 83 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 9.94922e-44 | 1 | 87 | 33 | 119 | unknown [Populus trichocarpa] |
EMBL | CBI28425.1 | 6.02558e-44 | 1 | 87 | 31 | 117 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002272811.1 | 5.60519e-45 | 1 | 87 | 32 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002272918.1 | 5.60519e-45 | 1 | 87 | 32 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002522909.1 | 4.06377e-44 | 1 | 87 | 31 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 4e-17 | 8 | 85 | 22 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EC945425 | 87 | 1 | 87 | 4.06377e-44 |
DT035040 | 88 | 1 | 88 | 9.94922e-44 |
DN488535 | 88 | 1 | 88 | 2.00386e-43 |
EE090966 | 88 | 1 | 88 | 2.00386e-43 |
CB918545 | 88 | 1 | 88 | 3.9937e-43 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|