CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_277.14
FamilyGT28
Protein PropertiesLength: 484 Molecular Weight: 54347.6 Isoelectric Point: 7.026
ChromosomeChromosome/Scaffold: 277 Start: 61686 End: 64235
Descriptionmonogalactosyldiacylglycerol synthase 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT282924501.6e-31
  VLLMGGGEGMGPVKKTAKALGESLYDKELEKPIGQLIIICGRNKVLASTLESEEWKIPVKVRGFETQMEKWMGACDCIITKAGPGTIAEALIRGLPIILN
  DYIPGQEKGNVPYVVDNGAGVFTRSPKETARIVKEWFSTKTDDLNKKSENALKLAQPEA
Full Sequence
Protein Sequence     Length: 484     Download
MVMTVASPRK TASITEKVFQ RVYSNFNLTA TATTATTTTS YGGTTHHHHH IKKSSSFENF    60
EEDYYDEEED GTMELAQMGA DRAKNVLILM SDTGGGHRAS AEAIRDAFKI EFGDEYNIFV    120
KDVWKEYTGW PLNNMERSYK FMVKHVQLWK VAFHGTSPRW IHSCYLAAIA AYYAKEVEAG    180
LMEYKPDIII SVHPLMQHIP LWVLKWQGLQ KKVIFVTVIT DLNTCHPTWF HPGVNRCYCP    240
SNEVAKRALL DGLDESQIRV YGLPIRPSFA RAFLLKDELR KELEMDPDLP AVLLMGGGEG    300
MGPVKKTAKA LGESLYDKEL EKPIGQLIII CGRNKVLAST LESEEWKIPV KVRGFETQME    360
KWMGACDCII TKAGPGTIAE ALIRGLPIIL NDYIPGQEKG NVPYVVDNGA GVFTRSPKET    420
ARIVKEWFST KTDDLNKKSE NALKLAQPEA VFDIVKDIHE LAKQRGPLAN IPYMFTSSFT    480
SLI* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0707MurG4.0e-2587464398+
PRK13608PRK136084.0e-3284461393+
PRK13609PRK136095.0e-4582469397+
pfam06925MGDG_synth4.0e-7897265169+
PLN02605PLN02605086465382+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0009247glycolipid biosynthetic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_568394.20134837468MGD2; 1,2-diacylglycerol 3-beta-galactosyltransferase/ UDP-galactosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002263443.1014831453PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324614.1044833474predicted protein [Populus trichocarpa]
RefSeqXP_002331019.10734831411predicted protein [Populus trichocarpa]
RefSeqXP_002530758.10148314701,2-diacylglycerol 3-beta-galactosyltransferase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
glycolipid biosynthesis2.4.1.46-RXNEC-2.4.1.46monogalactosyldiacylglycerol synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX5297593081364430
GO8450522991814790
EH6867462741173900
DT3392792961444390
HO466477381844640
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi4g30600.1Bradi3g54387.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna14993.1-v1.0-hybridmrna31719.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.001G039100.1Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1
Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.1LOC_Os08g20420.2
Panicum virgatumPavirv00042978mPavirv00044523mPavirv00010348mPavirv00051656mPavirv00029899m
Pavirv00008414mPavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.006G266500.1Potri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1
Potri.018G123000.1Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01035995001GSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)