CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_34.172
FamilyGH51
Protein PropertiesLength: 456 Molecular Weight: 50042.5 Isoelectric Point: 4.7336
ChromosomeChromosome/Scaffold: 34 Start: 1485252 End: 1488545
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH511733830
  SEILASANITVASSDVGNWTRKEFVLEAKGTDPHARLQLTTTTKGALWFDQVSAMPLDTYKGLGFRNDLFQMLVDIKPRFLRFPGGCYVEGEWLRNAFRW
  KETIGPWEQRPGHFGDVWKYWSDDGLGYLEYLQLAEELHAAPVWVFNIGISHNDEVNTTAVLPFIQEALDSIEFARGDSNSTWGSVRAELGHPEPFDLKY
  IALGNEDCGKP
Full Sequence
Protein Sequence     Length: 456     Download
MASKISCLLL LFVAASCVYQ SSALHAAKNQ TAWLTVDASE GSGRLIPETL FGIFFEEINH    60
AGVGGLWAEL VSNRGFEAGG SSVPSNIDPW TIIGDDSSVI VSTDLSSPFD SNRVALRMDV    120
LCDSDCPPRG VGVYNPGYWG MNIQGGKKYQ VVLYLRSSRE TSVAVSLASS NGSEILASAN    180
ITVASSDVGN WTRKEFVLEA KGTDPHARLQ LTTTTKGALW FDQVSAMPLD TYKGLGFRND    240
LFQMLVDIKP RFLRFPGGCY VEGEWLRNAF RWKETIGPWE QRPGHFGDVW KYWSDDGLGY    300
LEYLQLAEEL HAAPVWVFNI GISHNDEVNT TAVLPFIQEA LDSIEFARGD SNSTWGSVRA    360
ELGHPEPFDL KYIALGNEDC GKPNYRGFFA LLIFSTVLLA HNLTLHHERS KGYCDLPLLQ    420
LWNAWPFISE YAVTDGAGNG TLLSAVAEAG FLIWG*                              480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA4.0e-31236385158+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP97437.101845320485alpha-L-arabinofuranosidase [Malus x domestica]
GenBankABV32544.101845320485alpha-L-arabinofuranosidase protein [Prunus persica]
DDBJBAC99303.10845310485alpha-L-arabinofuranosidase [Pyrus pyrifolia]
DDBJBAF42035.10845310485alpha-Arabinosidase1 [Pyrus communis]
RefSeqNP_187685.10745313489ASD1 (ALPHA-L-ARABINOFURANOSIDASE 1); alpha-N-arabinofuranosidase/ hydrolase, acting on glycosyl bonds / xylan 1,4-beta-xylosidase [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ug5_F4e-1623638268196A Chain A, Crystal Structure Of The Precursor Of Galactose Oxidase
PDB3ug5_E4e-1623638268196A Chain A, Crystal Structure Of The Precursor Of Galactose Oxidase
PDB3ug5_D4e-1623638268196A Chain A, Crystal Structure Of The Precursor Of Galactose Oxidase
PDB3ug5_C4e-1623638268196A Chain A, Crystal Structure Of The Precursor Of Galactose Oxidase
PDB3ug5_B4e-1623638268196A Chain A, Crystal Structure Of The Precursor Of Galactose Oxidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT036166340173560
JG577027296943890
EE2554932731143820
BX84131132773290
GO801860304863890
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)