y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_42.121
FamilyCE8
Protein PropertiesLength: 557 Molecular Weight: 60477.7 Isoelectric Point: 6.4491
ChromosomeChromosome/Scaffold: 42 Start: 1082007 End: 1084721
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82465480
  VTVCKDAGSGCYKTVQEAVNAAPSDGTSRFVIHIKEGVYEEKVRVPFEKKNVVFVGDGMGKTVITGSSNVGQPGMSTYESATVGILGDGFMATGITIQNT
  AGPDAHQAVAFRSDSDFSVIQDCEFLGNQDTLYAHSLRQYYKSCSIQGNVDFIFGASAAVFEDCIILIAPRQQKPEHGENNAVTAHGRIDPSMSTGFVFY
  NCLINGTEEYMRLFHSKPAVHINYLGRPWKEYSRTVFIQCTLEALIVPAGWMPWSGDFALKTLYYGEYKNSGPGADVSHRVSWSSQIPEEHVNTYSVNNF
  IQG
Full Sequence
Protein Sequence     Length: 557     Download
MSSLLFFSLL SLLIFFNVSS ATRHHHHHSH SSSSSSPSLS PSTSPDSSSP PLAQIQQACK    60
ATRYPDVCVS SLSQSSRLPP NPTPLQIIQS AIWVSSQNLI TAKSMVNDIL KSSVGNLNRT    120
NAANICLQVL SYSQYRTSST DDALTRGRIK DARAWMSAAL AYQYDCWSGL KYVNDTTGVN    180
KTMSFLNSLV GLSSNALGMM VSYDNFGDAV SSWTAPRTER DGFWEKGGSV ESGGALGFPS    240
NLTADVTVCK DAGSGCYKTV QEAVNAAPSD GTSRFVIHIK EGVYEEKVRV PFEKKNVVFV    300
GDGMGKTVIT GSSNVGQPGM STYESATVGI LGDGFMATGI TIQNTAGPDA HQAVAFRSDS    360
DFSVIQDCEF LGNQDTLYAH SLRQYYKSCS IQGNVDFIFG ASAAVFEDCI ILIAPRQQKP    420
EHGENNAVTA HGRIDPSMST GFVFYNCLIN GTEEYMRLFH SKPAVHINYL GRPWKEYSRT    480
VFIQCTLEAL IVPAGWMPWS GDFALKTLYY GEYKNSGPGA DVSHRVSWSS QIPEEHVNTY    540
SVNNFIQGDE WAVTSS*                                                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02713PLN027131.0e-11058555544+
PLN02745PLN027457.0e-11555556528+
PLN02301PLN023018.0e-11655551508+
pfam01095Pectinesterase6.0e-161245549308+
PLN02708PLN02708053556510+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB09534.104355658577pectin methylesterase-like protein [Arabidopsis thaliana]
RefSeqNP_196538.104355632551pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002281640.102455623555PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002309906.102655631564predicted protein [Populus trichocarpa]
RefSeqXP_002517239.101955620552Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A02405513307A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02425511303B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B3e-182435243315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A3e-182435243315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B3e-182435243315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2711192372895250
EX6715762772785540
DT7451542802775560
EX2460332183255420
EX271119325265570.000000003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G09760.1AT5G64640.1
Brachypodium distachyonBradi2g56820.1Bradi5g10700.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna26037.1-v1.0-hybridmrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.003G067900.1Gorai.007G064900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004527mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os01g65790.1LOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.002G270900.1Phvul.009G148900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)