CAZyme Information

Basic Information
SpeciesCarica papaya
Cazyme IDevm.model.supercontig_62.32
FamilyCE10
Protein PropertiesLength: 165 Molecular Weight: 18144.4 Isoelectric Point: 5.2065
ChromosomeChromosome/Scaffold: 62 Start: 224120 End: 224786
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE106912.8e-23
  SPQYHDFCNKVAADANAVVVSVEYGLFPTRPIPACYEDSWTALQWVASHVAGDGPEPWLNHHADFQRVFIGGDSAGANISHTLAVR
Full Sequence
Protein Sequence     Length: 165     Download
MLSAFSPQYH DFCNKVAADA NAVVVSVEYG LFPTRPIPAC YEDSWTALQW VASHVAGDGP    60
EPWLNHHADF QRVFIGGDSA GANISHTLAV RVGSIGLPAE KDEYELREVG IDYCEKLKKS    120
GWNGSVEIVE HVGQSHVFHL KEETKLHEDA VVLVQKFVSL IKQD*                    180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07859Abhydrolase_30.0099614051+
COG0657Aes8.0e-969997+
pfam07859Abhydrolase_34.0e-1769995+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN61113.10116484300hypothetical protein [Vitis vinifera]
RefSeqXP_002282006.10116385300PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002285054.10116484300PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002518791.103164150364catalytic, putative [Ricinus communis]
RefSeqXP_002531391.10116492309catalytic, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2o7v_A1e-16111196204B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB2o7r_A1e-16111196204A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB3ed1_F0.0000000000001397127215A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB3ed1_E0.0000000000001397127215A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB3ed1_D0.0000000000001397127215A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
Metabolic Pathways
Pathway NameReactionECProtein Name
formononetin biosynthesisRXN-3284EC-4.2.1.1052-hydroxyisoflavanone dehydratase
isoflavonoid biosynthesis IRXN-3284EC-4.2.1.1052-hydroxyisoflavanone dehydratase
isoflavonoid biosynthesis IIRXN-3303EC-4.2.1.1052-hydroxyisoflavanone dehydratase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX279084214111650
EG66848822111650
FN743582193281650
FN743583193281650
EY69801319621420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00606.1.321.596Aquca_007_00606.1.321.596Aquca_015_00171.1Aquca_017_00080.1Aquca_015_00108.1
Aquca_015_00117.1Aquca_007_00602.1Aquca_028_00109.1Aquca_015_00115.1Aquca_054_00096.1
Aquca_007_00606.1.32.283Aquca_007_00606.1.32.283Aquca_007_00599.1Aquca_007_00607.1Aquca_007_00605.1
Aquca_007_00608.1
Arabidopsis lyrata485224484264473890891873891872
474099889348
Arabidopsis thalianaAT1G19190.1AT3G48700.1AT2G03550.1AT3G48690.1AT1G47480.1
AT1G49650.1AT1G49640.1AT1G49660.1
Brachypodium distachyonBradi4g32320.1Bradi4g32350.1Bradi3g38040.1Bradi4g32360.1Bradi1g45960.1
Bradi3g38045.1Bradi4g32080.1Bradi3g38080.1Bradi4g32310.1Bradi1g45930.1
Bradi4g32340.1Bradi1g45945.1Bradi3g38090.1Bradi1g45925.1Bradi4g32300.1
Bradi3g46460.1Bradi3g46450.1Bradi3g38060.1Bradi5g11800.1Bradi3g38050.1
Bradi4g32330.1Bradi1g74240.1Bradi3g38070.1
Brassica rapaBra019558Bra029912Bra029913Bra040667Bra014080
Bra016519Bra014213Bra018807Bra018808Bra018809
Bra025117Bra031068Bra025714
Carica papayaevm.model.supercontig_3272.2evm.model.supercontig_62.30evm.model.supercontig_62.31evm.TU.contig_24415.5evm.TU.contig_32334.1
evm.model.supercontig_2506.2evm.model.supercontig_2506.1evm.model.supercontig_1161.1
Capsella rubellaCarubv10019264mCarubv10017570mCarubv10011237mCarubv10018816mCarubv10011932m
Carubv10009807mCarubv10011215m
Citrus sinensisorange1.1g021920morange1.1g039671morange1.1g021927morange1.1g043287morange1.1g042745m
orange1.1g022120morange1.1g020576morange1.1g043192morange1.1g019090morange1.1g046334m
orange1.1g018914morange1.1g042897morange1.1g047391morange1.1g046886morange1.1g045768m
orange1.1g036491morange1.1g036685morange1.1g036128morange1.1g042415m
Cucumis sativusCucsa.085230.1Cucsa.085220.1Cucsa.232690.1Cucsa.123550.1Cucsa.085210.1
Eucalyptus grandisEucgr.I01163.1Eucgr.L02920.1Eucgr.I01162.1Eucgr.G01495.1Eucgr.G01468.1
Eucgr.I01161.1Eucgr.G01469.1Eucgr.G01488.1Eucgr.G01474.1Eucgr.J02632.1
Eucgr.G01482.1Eucgr.G01481.1Eucgr.H03554.1Eucgr.J02629.1Eucgr.G01478.1
Eucgr.G01491.1Eucgr.H03555.1Eucgr.G01473.1Eucgr.F00244.1Eucgr.F00249.1
Eucgr.F00245.1Eucgr.F00251.1Eucgr.I01166.1Eucgr.F00250.1Eucgr.G01472.1
Eucgr.J02635.1Eucgr.F00248.1
Fragaria vescamrna28524.1-v1.0-hybrid.43.286mrna28524.1-v1.0-hybrid.43.286mrna28524.1-v1.0-hybrid.43.286mrna28526.1-v1.0-hybridmrna28525.1-v1.0-hybrid
mrna28521.1-v1.0-hybridmrna28508.1-v1.0-hybridmrna28530.1-v1.0-hybridmrna28520.1-v1.0-hybridmrna28611.1-v1.0-hybrid
mrna05895.1-v1.0-hybridmrna05894.1-v1.0-hybrid.369.649mrna05894.1-v1.0-hybrid.369.649mrna28615.1-v1.0-hybridmrna05894.1-v1.0-hybrid.44.323
mrna05894.1-v1.0-hybrid.44.323mrna28538.1-v1.0-hybridmrna05898.1-v1.0-hybrid.12.296mrna05898.1-v1.0-hybrid.12.296mrna17534.1-v1.0-hybrid
mrna05898.1-v1.0-hybrid.317.605mrna05898.1-v1.0-hybrid.317.605mrna09075.1-v1.0-hybridmrna28524.1-v1.0-hybrid.366.514mrna28524.1-v1.0-hybrid.366.514
mrna28524.1-v1.0-hybrid.366.514mrna09070.1-v1.0-hybridmrna28524.1-v1.0-hybrid.590.683mrna28524.1-v1.0-hybrid.590.683mrna28524.1-v1.0-hybrid.590.683
Glycine maxGlyma17g36220.1Glyma02g15160.1Glyma02g15150.1Glyma02g15120.1Glyma07g33330.1
Glyma10g39610.1Glyma01g45000.1Glyma01g44980.1Glyma20g28150.1Glyma01g45020.1
Glyma11g00650.1Glyma02g15170.1Glyma07g33320.1Glyma10g39600.1Glyma06g04140.1
Glyma04g03980.1Glyma02g15130.1Glyma07g33340.2
Gossypium raimondiiGorai.006G237000.1Gorai.009G210800.1Gorai.005G239400.1Gorai.005G103700.1Gorai.008G025200.1
Gorai.009G210700.1Gorai.005G239000.1Gorai.005G239200.1Gorai.005G239100.1Gorai.013G042500.1
Gorai.005G103600.1
Linum usitatissimumLus10027909Lus10012073Lus10019882Lus10014036Lus10021743
Lus10014033.130.379Lus10014033.130.379Lus10042662Lus10021745Lus10034068
Lus10019884Lus10014035Lus10019885Lus10014033.36.130Lus10014033.36.130
Malus domesticaMDP0000227827MDP0000554950MDP0000204521MDP0000167495MDP0000199442
MDP0000375330MDP0000939384MDP0000818542MDP0000569026MDP0000847523
MDP0000204319MDP0000164293MDP0000281635MDP0000143216MDP0000849027
MDP0000594621MDP0000431260MDP0000864575MDP0000173546MDP0000180763
MDP0000849585MDP0000794484MDP0000857937MDP0000269558MDP0000617328
MDP0000256478MDP0000198493MDP0000816142MDP0000413509
Manihot esculentacassava4.1_013627mcassava4.1_030588mcassava4.1_026915mcassava4.1_032921mcassava4.1_034056m
cassava4.1_013203mcassava4.1_011889mcassava4.1_011928mcassava4.1_029685mcassava4.1_025530m
cassava4.1_032193mcassava4.1_027531m
Medicago truncatulaMedtr4g086510.1Medtr4g086480.1Medtr4g086470.1Medtr5g005920.1Medtr4g086540.1
Medtr5g005850.1Medtr8g040860.1Medtr3g101420.1Medtr1g105020.1Medtr1g104930.1.37.322
Medtr1g104930.1.37.322Medtr7g051020.1Medtr5g005900.1Medtr1g104930.1.359.644Medtr1g104930.1.359.644
Mimulus guttatusmgv1a010621mmgv1a024424mmgv1a026137mmgv1a026120mmgv1a025384m
mgv1a027087mmgv1a018666mmgv1a027056mmgv1a009954m
Oryza sativaLOC_Os07g34280.1LOC_Os07g34240.1LOC_Os07g34170.1LOC_Os07g34370.1LOC_Os09g28620.1
LOC_Os06g11135.1LOC_Os08g37060.1LOC_Os09g28750.1LOC_Os06g11130.1LOC_Os09g28650.1
LOC_Os09g28720.1LOC_Os09g28690.1LOC_Os09g28630.1LOC_Os09g28640.1LOC_Os06g11090.1
LOC_Os09g28740.1LOC_Os08g37050.1LOC_Os09g28280.1LOC_Os08g37010.1LOC_Os09g28660.1
LOC_Os04g37680.1LOC_Os08g37040.1LOC_Os07g31790.1LOC_Os08g37030.1LOC_Os09g26500.1
LOC_Os02g53960.1LOC_Os02g35940.1LOC_Os09g28230.1LOC_Os09g26490.1LOC_Os09g28730.1
Panicum virgatumPavirv00010950mPavirv00059932mPavirv00059669mPavirv00048957mPavirv00036486m
Pavirv00041653mPavirv00066993mPavirv00022926mPavirv00031619mPavirv00001305m
Pavirv00008370mPavirv00034008mPavirv00015345mPavirv00043956mPavirv00021034m
Pavirv00016224mPavirv00011282mPavirv00018935mPavirv00057305mPavirv00028685m
Pavirv00051325mPavirv00025716mPavirv00047727mPavirv00004795mPavirv00063650m
Pavirv00013381mPavirv00042358mPavirv00005219mPavirv00021754mPavirv00044490m
Pavirv00028359mPavirv00001805mPavirv00053058mPavirv00017045mPavirv00060730m
Pavirv00015344mPavirv00035674mPavirv00070588mPavirv00011281mPavirv00060290m
Pavirv00010525mPavirv00039903mPavirv00036503mPavirv00017037mPavirv00064437m
Pavirv00033220mPavirv00057127mPavirv00011407mPavirv00044972mPavirv00014292m
Pavirv00028361mPavirv00041308mPavirv00003420mPavirv00039358mPavirv00066709m
Pavirv00041518mPavirv00020850mPavirv00055834mPavirv00003513mPavirv00064414m
Pavirv00048233mPavirv00066949mPavirv00067390mPavirv00028157mPavirv00054492m
Pavirv00002162mPavirv00041087mPavirv00048523mPavirv00051389mPavirv00048779m
Phaseolus vulgarisPhvul.003G295300.1Phvul.003G295200.1Phvul.003G295100.1Phvul.003G295000.1Phvul.007G054300.1
Phvul.002G047500.1Phvul.009G063600.1Phvul.007G054200.1Phvul.007G054400.1Phvul.001G020500.1
Picea abiesMA_384628g0010MA_10429351g0010MA_10374213g0010MA_10435734g0010MA_81147g0010
MA_893141g0010MA_7763304g0010MA_104449g0020MA_872227g0010MA_2054728g0010
MA_10189777g0010
Populus trichocarpaPotri.004G142800.1Potri.009G104600.1Potri.004G142900.1Potri.009G105100.1Potri.004G142400.1
Potri.009G104100.1Potri.009G104000.1Potri.009G104900.1Potri.009G104300.1Potri.009G103800.1
Potri.009G104400.1Potri.009G105000.1Potri.014G032700.1Potri.004G143200.1Potri.014G032800.1
Potri.014G032600.1Potri.009G104700.1Potri.004G143100.1Potri.004G143200.2Potri.009G104200.1
Potri.014G032500.1
Prunus persicappa009174mppa026088mppa021861mppa008902mppa021907m
ppb022581mppa009160mppa007279mppa027099mppa007658m
ppa008575mppa008552mppa008795mppa021622mppa020422m
ppa009150mppa022718mppa021391m
Ricinus communis29801.m00320929168.m00036829168.m00036929801.m00321029801.m003171
29206.m00014529801.m00320829801.m00321130005.m00125429844.m003358
30170.m01390729801.m00321230170.m01390830179.m000575
Setaria italicaSi006900mSi008230mSi013972mSi014057mSi030499m
Si010584mSi032884mSi030180mSi030599mSi006704m
Si030193mSi006872mSi030583mSi030333mSi008594m
Si030549mSi013922mSi008542mSi032135mSi036667m
Si026497mSi013984mSi030607mSi033100mSi015649m
Si015677mSi032992mSi015570mSi031952mSi006888m
Si030298mSi031940mSi014909mSi010617mSi008447m
Si025325m
Sorghum bicolorSb02g026800.1Sb02g001850.1Sb10g007228.1Sb02g026816.1Sb02g026790.2
Sb02g026790.1Sb08g017820.1Sb10g007224.1Sb10g007226.1Sb02g026550.1.339.632
Sb02g026550.1.339.632Sb02g026550.1.33.325Sb02g026550.1.33.325Sb04g023520.1Sb10g008950.1
Sb07g023110.1Sb07g023140.1Sb09g014531.1Sb07g023070.1
Thellungiella halophilaThhalv10010541mThhalv10011580mThhalv10004622mThhalv10011663mThhalv10012216m
Thhalv10012081m
Vitis viniferaGSVIVT01031776001GSVIVT01009528001GSVIVT01031770001GSVIVT01031772001GSVIVT01031769001
GSVIVT01031773001.521.663GSVIVT01031773001.521.663GSVIVT01031773001.233.348GSVIVT01031773001.233.348GSVIVT01031775001
GSVIVT01035846001.57.161GSVIVT01035846001.57.161GSVIVT01035846001.57.161GSVIVT01035846001.57.161GSVIVT01017924001
Zea maysAC218900.3_FGT001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)