y
Basic Information | |
---|---|
Species | Carica papaya |
Cazyme ID | evm.model.supercontig_80.124 |
Family | GH1 |
Protein Properties | Length: 144 Molecular Weight: 17040.5 Isoelectric Point: 9.9098 |
Chromosome | Chromosome/Scaffold: 80 Start: 1051641 End: 1052232 |
Description | beta glucosidase 41 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 7 | 132 | 0 |
AASHWLHIVPWGIRKLMIYIRDKYENPHVIITENGMDDPNSPFITLNKALQDKKRINYHRDYLSNLSVAIRQDKCNIRGYFAWSLLDNWEWNSGYTVRFG LYYVDYKNNLTRIPKASVQWFKSILR |
Full Sequence |
---|
Protein Sequence Length: 144 Download |
MYSTTQAASH WLHIVPWGIR KLMIYIRDKY ENPHVIITEN GMDDPNSPFI TLNKALQDKK 60 RINYHRDYLS NLSVAIRQDK CNIRGYFAWS LLDNWEWNSG YTVRFGLYYV DYKNNLTRIP 120 KASVQWFKSI LRLTKSSHHL LDS* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02998 | PLN02998 | 2.0e-21 | 16 | 139 | 125 | + beta-glucosidase | ||
PRK13511 | PRK13511 | 5.0e-22 | 14 | 130 | 121 | + 6-phospho-beta-galactosidase; Provisional | ||
COG2723 | BglB | 8.0e-29 | 7 | 130 | 125 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
TIGR03356 | BGL | 3.0e-33 | 14 | 127 | 116 | + beta-galactosidase. | ||
pfam00232 | Glyco_hydro_1 | 7.0e-40 | 3 | 132 | 130 | + Glycosyl hydrolase family 1. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAB09336.1 | 0 | 9 | 131 | 368 | 490 | beta-glucosidase [Arabidopsis thaliana] |
EMBL | CBI20471.1 | 0 | 6 | 132 | 445 | 571 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_200268.3 | 0 | 6 | 131 | 380 | 505 | BGLU41 (BETA GLUCOSIDASE 41); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
RefSeq | XP_002280323.1 | 0 | 6 | 132 | 369 | 494 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002530914.1 | 0 | 6 | 133 | 364 | 491 | beta-glucosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3gnr_A | 0 | 6 | 132 | 361 | 487 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 3gnp_A | 0 | 6 | 132 | 361 | 487 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 3gno_A | 0 | 6 | 132 | 361 | 487 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
PDB | 1cbg_A | 2e-39 | 7 | 132 | 365 | 489 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
PDB | 3ptq_B | 1e-38 | 6 | 131 | 379 | 503 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DN488992 | 128 | 6 | 133 | 0 |
EL363793 | 132 | 6 | 137 | 0 |
BX254352 | 140 | 6 | 142 | 0 |
AM731873 | 127 | 6 | 132 | 0 |
GR202470 | 132 | 6 | 137 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|