| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv11b021044m |
| Family | CE10 |
| Protein Properties | Length: 128 Molecular Weight: 14188.4 Isoelectric Point: 8.4877 |
| Chromosome | Chromosome/Scaffold: 41 Start: 1427070 End: 1427453 |
| Description | alpha/beta-Hydrolases superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CE10 | 6 | 119 | 5.4e-22 |
| ALNHETCNRLSVDVSAIVVSVEFRIAPKSRLPSQYDDAMDAVLWVKSQAADRGDKWIRDHGDLDRCYLYGVSCGANIVFNTALRMMEMKPPPMRVAGVVL NQPFFGGKKRTKSE | |||
| Full Sequence |
|---|
| Protein Sequence Length: 128 Download |
| MTISDALNHE TCNRLSVDVS AIVVSVEFRI APKSRLPSQY DDAMDAVLWV KSQAADRGDK 60 WIRDHGDLDR CYLYGVSCGA NIVFNTALRM MEMKPPPMRV AGVVLNQPFF GGKKRTKSEL 120 SPVEISR* |
| Functional Domains Download unfiltered results here | ||||||
|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
| COG2267 | PldB | 0.0006 | 34 | 111 | 78 | + Lysophospholipase [Lipid metabolism] |
| COG0657 | Aes | 9.0e-10 | 8 | 118 | 111 | + Esterase/lipase [Lipid metabolism] |
| pfam07859 | Abhydrolase_3 | 4.0e-22 | 9 | 108 | 100 | + alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes. |
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016787 | hydrolase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN81468.1 | 1e-35 | 2 | 124 | 84 | 209 | hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002272186.1 | 2e-35 | 2 | 120 | 145 | 266 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002277011.1 | 9e-36 | 2 | 120 | 95 | 216 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002301311.1 | 7e-38 | 9 | 120 | 103 | 215 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002511754.1 | 3e-37 | 9 | 124 | 96 | 212 | Gibberellin receptor GID1, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2o7v_A | 3e-26 | 9 | 127 | 105 | 221 | A Chain A, Human Beta-Hexosaminidase B |
| PDB | 2o7r_A | 3e-26 | 9 | 127 | 105 | 221 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
| PDB | 3ed1_F | 0.0000000000004 | 2 | 119 | 131 | 236 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
| PDB | 3ed1_E | 0.0000000000004 | 2 | 119 | 131 | 236 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
| PDB | 3ed1_D | 0.0000000000004 | 2 | 119 | 131 | 236 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| GO981616 | 120 | 1 | 120 | 0 |
| GO978945 | 120 | 1 | 120 | 0 |
| GO978433 | 120 | 1 | 120 | 0 |
| GR068161 | 122 | 1 | 120 | 0 |
| GO999658 | 125 | 1 | 125 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
