| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv11b021156m |
| Family | CBM43 |
| Protein Properties | Length: 104 Molecular Weight: 11432.7 Isoelectric Point: 4.2966 |
| Chromosome | Chromosome/Scaffold: 23 Start: 763190 End: 763501 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 25 | 100 | 1.3e-21 |
| WCISQANAPQDKLQAFIDYGCGVVDCSTIQLGGRCYDPNTVEGHASYVLDLVYKKQNSCNTDVGIITTVDPSYEGC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 104 Download |
| FFLFGVVYGY ETKFEPNGHK QTVNWCISQA NAPQDKLQAF IDYGCGVVDC STIQLGGRCY 60 DPNTVEGHAS YVLDLVYKKQ NSCNTDVGII TTVDPSYEGC DYP* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-8 | 25 | 82 | 64 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 8.0e-22 | 25 | 102 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK95331.1 | 1e-17 | 11 | 103 | 354 | 452 | unknown [Populus trichocarpa] |
| RefSeq | NP_001068545.1 | 4e-16 | 25 | 102 | 347 | 429 | Os11g0704600 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_001767901.1 | 4e-16 | 16 | 103 | 359 | 453 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_002451320.1 | 6e-17 | 25 | 102 | 383 | 465 | hypothetical protein SORBIDRAFT_05g027690 [Sorghum bicolor] |
| RefSeq | XP_002509479.1 | 1e-16 | 11 | 103 | 358 | 456 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 7e-16 | 20 | 103 | 8 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR181552 | 104 | 1 | 104 | 0 |
| GO245609 | 104 | 2 | 104 | 3e-21 |
| BQ988919 | 81 | 24 | 104 | 1e-20 |
| DW155140 | 81 | 24 | 104 | 1e-18 |
| DW155080 | 81 | 24 | 104 | 2e-18 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |