Basic Information | |
---|---|
Species | Mimulus guttatus |
Cazyme ID | mgv11b023492m |
Family | CE10 |
Protein Properties | Length: 128 Molecular Weight: 14188.4 Isoelectric Point: 8.4877 |
Chromosome | Chromosome/Scaffold: 48 Start: 642224 End: 642607 |
Description | alpha/beta-Hydrolases superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE10 | 6 | 119 | 5.4e-22 |
ALNHETCNRLSVDVSAIVVSVEFRIAPKSRLPSQYDDAMDAVLWVKSQAADRGDKWIRDHGDLDRCYLYGVSCGANIVFNTALRMMEMKPPPMRVAGVVL NQPFFGGKKRTKSE |
Full Sequence |
---|
Protein Sequence Length: 128 Download |
MTISDALNHE TCNRLSVDVS AIVVSVEFRI APKSRLPSQY DDAMDAVLWV KSQAADRGDK 60 WIRDHGDLDR CYLYGVSCGA NIVFNTALRM MEMKPPPMRV AGVVLNQPFF GGKKRTKSEL 120 SPVEISR* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
COG2267 | PldB | 0.0006 | 34 | 111 | 78 | + Lysophospholipase [Lipid metabolism] | ||
COG0657 | Aes | 9.0e-10 | 8 | 118 | 111 | + Esterase/lipase [Lipid metabolism] | ||
pfam07859 | Abhydrolase_3 | 4.0e-22 | 9 | 108 | 100 | + alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016787 | hydrolase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN81468.1 | 1e-35 | 2 | 124 | 84 | 209 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002272186.1 | 2e-35 | 2 | 120 | 145 | 266 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002277011.1 | 9e-36 | 2 | 120 | 95 | 216 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002301311.1 | 7e-38 | 9 | 120 | 103 | 215 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002511754.1 | 3e-37 | 9 | 124 | 96 | 212 | Gibberellin receptor GID1, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2o7v_A | 3e-26 | 9 | 127 | 105 | 221 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 2o7r_A | 3e-26 | 9 | 127 | 105 | 221 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3ed1_F | 0.0000000000004 | 2 | 119 | 131 | 236 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3ed1_E | 0.0000000000004 | 2 | 119 | 131 | 236 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3ed1_D | 0.0000000000004 | 2 | 119 | 131 | 236 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GO981616 | 120 | 1 | 120 | 0 |
GO978945 | 120 | 1 | 120 | 0 |
GO978433 | 120 | 1 | 120 | 0 |
GR068161 | 122 | 1 | 120 | 0 |
GO999658 | 125 | 1 | 125 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|