CAZyme Information

Basic Information
SpeciesMimulus guttatus
Cazyme IDmgv1a001301m
FamilyGH13
Protein PropertiesLength: 845 Molecular Weight: 95692.7 Isoelectric Point: 5.1403
ChromosomeChromosome/Scaffold: 210 Start: 262856 End: 271703
Descriptionstarch branching enzyme 2.2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133456661.1e-29
  LPRIKKLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPDDLKSLIDKAHELGLVVLMDIVHSHSSNNTLDGLNMFDGTDSCYFHSGTRGYHWMWD
  SRLFNYGQWEVLRFLLSNARWWLDEYKFDGFRFDGVTSMMYTHHGLQMAFTGNYSEYFGFATDVDAVAYLMLVNDLIHGLFPEAITIGEDVSGMPAFCIP
  LQDGGMGFDYRLHMAIADKWIETLKKRDEEWSMGDIIHTLTNRRWREKCVCYAESHDQALVGDKTIAFWLMDKDMYDFMAVDRPSTPLIDRGIALHKMIR
  LITMGLGGEGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 845     Download
MVYTLPGVRL PTVPSAAYKV GSCGMIFSGG KAYESGFQPS MATAPEKVLV PGTESDGSSS    60
PRENLEIVSG TSQACNLESV DGPIVKEQEQ LIEQQISGEA IKGKDSASVQ LLDEDAGLNT    120
EGKSYSISKT IADESSMVKE RVIPPPGAGQ KIYEIDTLLT NYREHLDYRY GQYKKLRDAI    180
DKYEGGLEVF SRGYEKLGFN RSETGITYRE WAPGAKSASL IGDFNNWNAN ADVMTRNEFG    240
VWEIFLPNNA DGSPAIPHGS RVKIRMDTPS GIKDSIPAWI KFSVQAPGEI PYNGIYYDPP    300
VEERYVFKHP RPSKPKSLRI YECHVGMSST EPVINTYANF RDEVLPRIKK LGYNAVQIMA    360
IQEHSYYASF GYHVTNFFAP SSRFGTPDDL KSLIDKAHEL GLVVLMDIVH SHSSNNTLDG    420
LNMFDGTDSC YFHSGTRGYH WMWDSRLFNY GQWEVLRFLL SNARWWLDEY KFDGFRFDGV    480
TSMMYTHHGL QMAFTGNYSE YFGFATDVDA VAYLMLVNDL IHGLFPEAIT IGEDVSGMPA    540
FCIPLQDGGM GFDYRLHMAI ADKWIETLKK RDEEWSMGDI IHTLTNRRWR EKCVCYAESH    600
DQALVGDKTI AFWLMDKDMY DFMAVDRPST PLIDRGIALH KMIRLITMGL GGEGYLNFMG    660
NEFGHPEWID FPRGDQHLPD GRVIPGNGNS YDKCRRRFDL GDAEYLRYHG LQEFDQAMQH    720
LEENYGFMTS EHQYISRKDE ADRVIVFERG NLLFVFNFHW SKSYSDYRVG CLKPGKYKVA    780
LDSDDKLFGG FGRISHEAEY FTSEGWQDDR PRSFYIYAPS RTAVVYALAE VEAEPIDVQV    840
SPNV* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029607.0e-1016924684+
PLN03244PLN032441.0e-141254822577+
PLN02447PLN02447093822734+
cd11321AmyAc_bac_euk_BE0302716416+
PLN02960PLN029600254822574+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB64912.1018371867starch branching enzyme II [Ipomoea batatas]
EMBLCAA56319.1018381855starch branching enzyme I [Pisum sativum]
EMBLCAB40743.1018371870starch branching enzyme II [Solanum tuberosum]
EMBLCAB40746.1018301858starch branching enzyme II [Solanum tuberosum]
EMBLCAB40747.10268271810starch branching enzyme II [Solanum tuberosum]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A015283613700A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B015283613700A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A015283613700A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3aml_A015283613700A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3k1d_A0204824136717A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7945366771468220
HO7776386212028220
HO4581233884358220
HO4581232941464340
HO777638471552010.00000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)