CAZyme Information

Basic Information
SpeciesMimulus guttatus
Cazyme IDmgv1a001549m
FamilyGH13
Protein PropertiesLength: 799 Molecular Weight: 90141.3 Isoelectric Point: 5.2601
ChromosomeChromosome/Scaffold: 48 Start: 92100 End: 96990
Descriptionisoamylase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132496350
  KYPGTYLGVVEKLDYLKKLGVNCIELMPCHEFNELEYYSYNPVLGDYKMNFWGYSTINYFSPMARYSSSGIGNYGIGAVNDFKYLVREAHKRGIEVIMDV
  VFNHTAEGNENGPILSFRGLDNSVFYMLAPKGEYYNYSGCGNTFNCNHPIVRQFIVDSLRYWVTEMHVDGFRFDLASIMTRSSSLWDAVNVYGSAIEGET
  VTTGTPLGSPPLVDMISNDPILRGVKLIAEAWDCGGLYQVGMFPHWSIWSEWNGKYRDTVRQFIKGTDGFSGAFAECLCGSPNLYKEGGRKPWNSINFVC
  AHDGFTLADLVTYNNKHNLANGEENKDGEDHNNSWNCGQEGEFASISVKKLRRRQMRNFFLCLMVSQGVPMIYMGDEYGHTKGGNNN
Full Sequence
Protein Sequence     Length: 799     Download
METQFLHNFT IPNYRSPKFS SKKYLRRRKN ELNAGITSKP FENSGTNPNP YITLSTASGR    60
GDAETAVVVE KPPPKPPSFE VFSGNPMPFG ATPGDGGVNF SVVSSNASSA TLCLITLSDL    120
QERRVTEQIA LNPLTNKTGD VWHVFLKGDF EDMVYAYRFD GSFCPEDGLY FDSSKLLIDP    180
YAKAVVSRGE YGALGTGDEC WPQMACLVPS TTDEFDWEGD LPLKLPQRDL FMYEMHVRGF    240
TRHESSNSKY PGTYLGVVEK LDYLKKLGVN CIELMPCHEF NELEYYSYNP VLGDYKMNFW    300
GYSTINYFSP MARYSSSGIG NYGIGAVNDF KYLVREAHKR GIEVIMDVVF NHTAEGNENG    360
PILSFRGLDN SVFYMLAPKG EYYNYSGCGN TFNCNHPIVR QFIVDSLRYW VTEMHVDGFR    420
FDLASIMTRS SSLWDAVNVY GSAIEGETVT TGTPLGSPPL VDMISNDPIL RGVKLIAEAW    480
DCGGLYQVGM FPHWSIWSEW NGKYRDTVRQ FIKGTDGFSG AFAECLCGSP NLYKEGGRKP    540
WNSINFVCAH DGFTLADLVT YNNKHNLANG EENKDGEDHN NSWNCGQEGE FASISVKKLR    600
RRQMRNFFLC LMVSQGVPMI YMGDEYGHTK GGNNNTYCHD NFINYFRWDK MEEASSDFFR    660
FCCLVSKFRH ECESLGLNDF LTAERLQWHG YAPGIPDWSD TSRFVAFTLR DSVKGELYIA    720
FNASHVAVTV ALPERPGYRW DPLVDTGKPA PFDFITDDLP DRQVAIRQYA HFLDNNLYPM    780
ISYSSIILSL SPDTTTYS* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145106.0e-13584737690+
PRK03705PRK037055.0e-15384658589+
cd11326AmyAc_Glg_debranch0215671462+
COG1523PulA084766711+
TIGR02100glgX_debranch084764728+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN15317.1047912788isoamylase isoform 1 [Solanum tuberosum]
DDBJBAF52941.1097934788isoamylase-type starch-debranching enzyme 1 [Phaseolus vulgaris]
EMBLCBI40669.105679264804unnamed protein product [Vitis vinifera]
RefSeqXP_002308090.1077939823predicted protein [Populus trichocarpa]
RefSeqXP_002324659.1077979795predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B08473415676A Chain A, Peanut Peroxidase
PDB2vuy_A08473415676A Chain A, Peanut Peroxidase
PDB2vr5_B08473415676A Chain A, Peanut Peroxidase
PDB2vr5_A08473415676A Chain A, Peanut Peroxidase
PDB2vnc_B08473415676A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8002352654917550
HO8002351103264350
HO800235584324890
HO4312284063687730
DW0655502914707600
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)