CAZyme Information

Basic Information
SpeciesMimulus guttatus
Cazyme IDmgv1a002417m
FamilyGH13
Protein PropertiesLength: 679 Molecular Weight: 77492 Isoelectric Point: 5.1027
ChromosomeChromosome/Scaffold: 35 Start: 123073 End: 136532
Descriptionisoamylase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH131695340
  NIRGSYLGLIEKIPHLVELGVNAVELLPVFEFDEMELQRRPNPRDHMINTWGYSTTNFFAPMSRYASNGGGPINASLEFKEMVKALHSAGIEVILDVVYN
  HTNEADDENPYTTSFRGIDNKVYYIVDFNNNAKLLNYSGCGNTLNCNHPVVMELILDSLRHWVTEYHVDGFRFDLASVLCRGTDGSPLNSPPLIREIAKD
  EILSRCKIIAEPWDCGGLYLVGKFPNWDRWAEWNGIYRDDIRRFIKGDNSMKGSFATRIAGSADLYQVNKRKPCHGINFVIAHDGFTLYDLVSYNFKHND
  ANGEGGNDGCNDNFSWNCGFEGETSDKDIKALRLRQMKNFHVALMVSQGTPMMLMGDEYGHTRYGN
Full Sequence
Protein Sequence     Length: 679     Download
MKVLPGQPHP LGVSEVENGT NFAIFSQSAT AVTLCLLLHE RDQEMIELSL DAEVNKTGDI    60
WHICVQDLPR SNVLYVYRVN GPEDWHQGHR FDYGNLLLDP YAKLIEGRRV FGDASDKMSN    120
FFGTYDFDCL PFDWGENYKL PNIHEKDLVI YEMNVRAFTA DESSAMDPNI RGSYLGLIEK    180
IPHLVELGVN AVELLPVFEF DEMELQRRPN PRDHMINTWG YSTTNFFAPM SRYASNGGGP    240
INASLEFKEM VKALHSAGIE VILDVVYNHT NEADDENPYT TSFRGIDNKV YYIVDFNNNA    300
KLLNYSGCGN TLNCNHPVVM ELILDSLRHW VTEYHVDGFR FDLASVLCRG TDGSPLNSPP    360
LIREIAKDEI LSRCKIIAEP WDCGGLYLVG KFPNWDRWAE WNGIYRDDIR RFIKGDNSMK    420
GSFATRIAGS ADLYQVNKRK PCHGINFVIA HDGFTLYDLV SYNFKHNDAN GEGGNDGCND    480
NFSWNCGFEG ETSDKDIKAL RLRQMKNFHV ALMVSQGTPM MLMGDEYGHT RYGNNNSYGH    540
DNALNHFQWG QLEDKKNNLF RFFSEMIKFR RSHNVFTREN FIGKNEVTWH EDNWENTESK    600
FLAFTLHEEN GGDLYVAFNA HDYFVKAAIP SPPQTRQWFR MVDTNLESPS DLVPEGVPGV    660
KEMYNMAPYS SIILQAKP* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145106.0e-1393633666+
PRK03705PRK037052.0e-1571572592+
cd11326AmyAc_Glg_debranch0132573445+
COG1523PulA01649690+
TIGR02100glgX_debranch05649692+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN15319.10167788765isoamylase isoform 3 [Solanum tuberosum]
GenBankAAZ81837.10267756735isoamylase isoform 3 [Pisum sativum]
EMBLCBI19205.10167792774unnamed protein product [Vitis vinifera]
RefSeqXP_002284042.101677104786PREDICTED: similar to isoamylase-type starch-debranching enzyme 3 [Vitis vinifera]
RefSeqXP_002513977.103677101781isoamylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B0558114599A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB2vuy_A0558114599A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB2vr5_B0558114599A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB2vr5_A0558114599A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB2vnc_B0558114599A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO798725452965470
HO4308582604206770
HO4308581642524150
HO4308581291272550
HO798725355625960.0002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)