CAZyme Information

Basic Information
SpeciesMimulus guttatus
Cazyme IDmgv1a009704m
FamilyAA2
Protein PropertiesLength: 335 Molecular Weight: 35820.2 Isoelectric Point: 7.6805
ChromosomeChromosome/Scaffold: 335 Start: 93183 End: 94742
DescriptionPeroxidase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2543170
  ASLTDPTTPAALLRLMFHDCQVQGCDASILVNPDGVITKSSEMGSTKNFGIRKRELISLVKSAVEAVCPRRVSCADILVMAAHEAVAFSGGPRIIRLPLG
  RRDSINPPNAGLADASLPHADIGLDSTLQLFAKKGMTIEESVAILGAHTLGVTHCINLQSRLYSTQKSNATNQNPAFELSLKTRCPQLAGPTASKISFMQ
  NDLTSVIFDNEYFVNLMRGRGLLNIDSDMAVDSRTRQFVEKFAEDQGAFFRAFSSAFVKLSSYG
Full Sequence
Protein Sequence     Length: 335     Download
MMRVGVIVGV VFVVVVVLGC LKNGEAVGVG LSDNFYEESC PEVESIVRAG VQSASLTDPT    60
TPAALLRLMF HDCQVQGCDA SILVNPDGVI TKSSEMGSTK NFGIRKRELI SLVKSAVEAV    120
CPRRVSCADI LVMAAHEAVA FSGGPRIIRL PLGRRDSINP PNAGLADASL PHADIGLDST    180
LQLFAKKGMT IEESVAILGA HTLGVTHCIN LQSRLYSTQK SNATNQNPAF ELSLKTRCPQ    240
LAGPTASKIS FMQNDLTSVI FDNEYFVNLM RGRGLLNIDS DMAVDSRTRQ FVEKFAEDQG    300
AFFRAFSSAF VKLSSYGVLT GNRGVVRRSC GALD* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase7.0e-526729832+
cd00691ascorbate_peroxidase3.0e-27124318203+
pfam00141peroxidase9.0e-4647215170+
PLN03030PLN030309.0e-6028334316+
cd00693secretory_peroxidase2.0e-12430332305+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAA94985.102533414321peroxidase-like protein [Arabidopsis thaliana]
EMBLCAN70977.102831722305hypothetical protein [Vitis vinifera]
RefSeqNP_566565.102533432339peroxidase, putative [Arabidopsis thaliana]
RefSeqXP_002272979.102833422325PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002440832.1033309333hypothetical protein SORBIDRAFT_09g007950 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0313302290A Chain A, Peanut Peroxidase
PDB1sch_A0313302290A Chain A, Peanut Peroxidase
PDB1qo4_A0313303300A Chain A, Peanut Peroxidase
PDB1pa2_A0313303300A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1gwo_A0313303302A Chain A, Recombinant Horseradish Peroxidase C1a Ala170gln
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO98819224212420
GR130338193182100
GO9881931851513350
GO97624822412240
GO976248411982380.00000000000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00478.1Aquca_005_00071.2Aquca_005_00071.1Aquca_016_00057.1Aquca_005_00071.3
Arabidopsis lyrata898035492673345443
Arabidopsis thalianaAT3G17070.1AT2G37130.2AT2G37130.1AT4G21960.1
Brassica rapaBra022195Bra017206Bra023099Bra013576
Carica papayaevm.model.supercontig_152.14evm.model.supercontig_525.1
Capsella rubellaCarubv10014103mCarubv10023623mCarubv10005223m
Citrus clementinaCiclev10026124mCiclev10026035mCiclev10012170mCiclev10015870mCiclev10016494m
Citrus sinensisorange1.1g045164morange1.1g020143morange1.1g020084morange1.1g021519morange1.1g019854m
orange1.1g019129morange1.1g021841morange1.1g026488morange1.1g020712morange1.1g021207m
orange1.1g028028morange1.1g036121m
Cucumis sativusCucsa.307020.2Cucsa.307020.1Cucsa.085830.1Cucsa.124250.1Cucsa.307020.3
Eucalyptus grandisEucgr.E03999.1Eucgr.E04056.1Eucgr.D01322.1Eucgr.A01166.1
Fragaria vescamrna05105.1-v1.0-hybridmrna25836.1-v1.0-hybridmrna19619.1-v1.0-hybridmrna09649.1-v1.0-hybrid
Glycine maxGlyma07g39290.1Glyma17g01440.2Glyma13g20170.1Glyma10g05800.1Glyma17g01720.1
Glyma07g39020.1Glyma04g10761.1
Gossypium raimondiiGorai.011G200600.1Gorai.006G168000.3Gorai.006G168000.1Gorai.009G419100.1Gorai.006G168000.2
Gorai.009G178400.1
Linum usitatissimumLus10015074Lus10006778Lus10020045
Malus domesticaMDP0000292744MDP0000124622MDP0000303101MDP0000545323MDP0000192235
Manihot esculentacassava4.1_011604mcassava4.1_012064mcassava4.1_031903m
Medicago truncatulaMedtr6g045330.1Medtr4g132490.1Medtr4g132110.2Medtr1g066380.1Medtr4g132110.1
Medtr1g066380.2Medtr4g132110.3
Mimulus guttatusmgv1a009981mmgv1a010406mmgv1a007622mmgv1a010067mmgv1a019681m
mgv1a025816mmgv1a026804m
Oryza sativaLOC_Os07g49360.1LOC_Os05g14260.1
Panicum virgatumPavirv00050429mPavirv00010935m
Physcomitrella patensPp1s8_186V6.1Pp1s44_71V6.1Pp1s10_225V6.1Pp1s62_126V6.1Pp1s16_148V6.1
Pp1s104_177V6.3Pp1s104_177V6.2Pp1s104_177V6.1Pp1s433_15V6.2Pp1s433_15V6.1
Phaseolus vulgarisPhvul.007G107400.1Phvul.003G078600.1
Picea abiesMA_83406g0010MA_530154g0010MA_10432809g0020MA_10427936g0010MA_6481365g0010
MA_10432809g0010
Populus trichocarpaPotri.004G015300.2Potri.004G015300.1Potri.006G129900.1Potri.004G006400.1
Prunus persicappa008634mppa022386mppa008503m
Ricinus communis29842.m00359530078.m002355
Setaria italicaSi022597m
Selaginella moellendorffii10502977725116945140930107369
1370671793877725976459403456
11598223276377662
Sorghum bicolorSb09g007950.1Sb09g018150.1
Thellungiella halophilaThhalv10021081mThhalv10016921mThhalv10025680m
Vitis viniferaGSVIVT01034984001GSVIVT01025650001GSVIVT01012727001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)