| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a016537m |
| Family | CBM43 |
| Protein Properties | Length: 118 Molecular Weight: 12928.6 Isoelectric Point: 5.5594 |
| Chromosome | Chromosome/Scaffold: 122 Start: 231126 End: 232218 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 29 | 112 | 1.1e-32 |
| WCIADEQTPDSELQAGLDWACGKGGANCSKIQPGQACFKPDTVRAHSSYAFNNYYQKFKHRGGSCYFNSAAITTDLNPSHDSCN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 118 Download |
| MPIVKIFLLL SLLLVINYSL KSDGVLEDWC IADEQTPDSE LQAGLDWACG KGGANCSKIQ 60 PGQACFKPDT VRAHSSYAFN NYYQKFKHRG GSCYFNSAAI TTDLNPSHDS CNYELTP* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 3.0e-16 | 29 | 100 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 8.0e-35 | 29 | 113 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI28425.1 | 0 | 1 | 117 | 1 | 117 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002272811.1 | 0 | 21 | 117 | 21 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002272918.1 | 0 | 21 | 117 | 21 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002307902.1 | 0 | 2 | 117 | 3 | 118 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002321180.1 | 0 | 1 | 117 | 1 | 117 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 9e-18 | 29 | 113 | 13 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
