| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a016631m |
| Family | CBM43 |
| Protein Properties | Length: 115 Molecular Weight: 12528.3 Isoelectric Point: 4.9549 |
| Chromosome | Chromosome/Scaffold: 23 Start: 760100 End: 760646 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 36 | 112 | 7.2e-22 |
| WCISQANAPQDKLQAFIDYGCGVVDCSAIQLGGPCYDPDTVVGHASYVLDLVYKKQSSCNTDVGIITTVDPSYESCK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 115 Download |
| MNKTKVPLFL VFCLFGVVYG YEAKFEPNGH KQTVNWCISQ ANAPQDKLQA FIDYGCGVVD 60 CSAIQLGGPC YDPDTVVGHA SYVLDLVYKK QSSCNTDVGI ITTVDPSYES CKYP* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-8 | 36 | 95 | 70 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-24 | 36 | 113 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | EEC79758.1 | 5e-16 | 36 | 114 | 109 | 193 | hypothetical protein OsI_21142 [Oryza sativa Indica Group] |
| GenBank | EEE64827.1 | 4e-16 | 36 | 114 | 109 | 193 | hypothetical protein OsJ_19684 [Oryza sativa Japonica Group] |
| RefSeq | NP_001117561.1 | 1e-16 | 30 | 113 | 20 | 109 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_176859.1 | 6e-17 | 30 | 113 | 20 | 110 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | XP_002532848.1 | 4e-17 | 32 | 114 | 357 | 445 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 0.00000000000005 | 31 | 114 | 8 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 20 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR181552 | 115 | 1 | 115 | 0 |
| GO245609 | 116 | 1 | 115 | 9e-22 |
| BQ988919 | 81 | 35 | 115 | 1e-20 |
| DW155140 | 81 | 35 | 115 | 2e-19 |
| DW155080 | 81 | 35 | 115 | 2e-19 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |