| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a018426m |
| Family | CBM43 |
| Protein Properties | Length: 94 Molecular Weight: 10186.5 Isoelectric Point: 4.7567 |
| Chromosome | Chromosome/Scaffold: 274 Start: 196486 End: 196767 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 15 | 91 | 1.7e-21 |
| WCISNIQASQDSLLGLINYGCGVVDCSAIQPGGLCYDPNTITSHANYVLNLIYVKNRTCDWHVGMVVQIDPSYGNCK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 94 Download |
| TNFEPNGEKV LANSWCISNI QASQDSLLGL INYGCGVVDC SAIQPGGLCY DPNTITSHAN 60 YVLNLIYVKN RTCDWHVGMV VQIDPSYGNC KYP* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam02145 | Rap_GAP | 0.009 | 46 | 83 | 38 | + Rap/ran-GAP. | ||
| pfam07983 | X8 | 3.0e-7 | 14 | 75 | 72 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 3.0e-22 | 14 | 92 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAX95270.1 | 3e-17 | 15 | 92 | 388 | 470 | glucan endo-1,3-beta-glucosidase precursor (ec 3.2.1.39) ((1-3)-beta-glucan endohydrolase) ((1-3)-beta-glucanase) (beta-1,3-endoglucanase) [Oryza sativa Japonica Group] |
| GenBank | EEE52578.1 | 2e-17 | 15 | 92 | 758 | 840 | hypothetical protein OsJ_34867 [Oryza sativa Japonica Group] |
| RefSeq | NP_001068545.1 | 1e-17 | 15 | 92 | 347 | 429 | Os11g0704600 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001151529.1 | 8e-18 | 3 | 92 | 353 | 449 | LOC100285163 [Zea mays] |
| RefSeq | XP_002451320.1 | 5e-18 | 15 | 92 | 383 | 465 | hypothetical protein SORBIDRAFT_05g027690 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 3e-18 | 5 | 93 | 3 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR181552 | 94 | 1 | 94 | 3e-31 |
| ES304050 | 86 | 12 | 92 | 2e-18 |
| FL850651 | 88 | 10 | 92 | 4e-18 |
| BQ988919 | 85 | 10 | 94 | 4e-18 |
| FL876171 | 86 | 12 | 92 | 6e-18 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |