| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a018503m |
| Family | CBM43 |
| Protein Properties | Length: 107 Molecular Weight: 11426.2 Isoelectric Point: 6.4593 |
| Chromosome | Chromosome/Scaffold: 29 Start: 71983 End: 72303 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 32 | 107 | 2.2e-21 |
| WCIAIANTPADKLQGFIDYACGVIDCSAILPGGPCYAPNNLLAHTDYALNQFYKSRGTCNADIGAIITIDPSYGNC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 107 Download |
| MEKINISLFL ICLLVGVAHS KSTIGRKQAV DWCIAIANTP ADKLQGFIDY ACGVIDCSAI 60 LPGGPCYAPN NLLAHTDYAL NQFYKSRGTC NADIGAIITI DPSYGNC |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-9 | 32 | 88 | 63 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-22 | 32 | 107 | 82 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAB10565.1 | 8e-16 | 19 | 107 | 80 | 174 | unnamed protein product [Arabidopsis thaliana] |
| DDBJ | BAB10565.1 | 0.0000000001 | 32 | 88 | 26 | 83 | unnamed protein product [Arabidopsis thaliana] |
| RefSeq | NP_001078788.1 | 9e-16 | 31 | 107 | 24 | 106 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_001117561.1 | 0.000000000000001 | 28 | 107 | 22 | 107 | unknown protein [Arabidopsis thaliana] |
| RefSeq | XP_002528491.1 | 8e-16 | 4 | 107 | 8 | 114 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 0.0000000000005 | 23 | 107 | 4 | 94 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 20 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR181552 | 111 | 1 | 107 | 1e-32 |
| GO245609 | 112 | 1 | 107 | 5e-22 |
| FS242658 | 99 | 16 | 107 | 1e-18 |
| GR721658 | 95 | 19 | 107 | 2e-17 |
| BJ287025 | 106 | 8 | 107 | 2e-17 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |