| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a018746m |
| Family | CBM43 |
| Protein Properties | Length: 94 Molecular Weight: 10146.4 Isoelectric Point: 4.5492 |
| Chromosome | Chromosome/Scaffold: 274 Start: 185918 End: 186199 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 15 | 91 | 5.3e-22 |
| WCIAKPNAPQDKLQGFINYACGEVDCGVVQPGGQCYDPNTVLSHASYVLDLIYIYRKSCNPDIGIITTVDPSYGDCK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 94 Download |
| TNSKPSGQKD IPDTWCIAKP NAPQDKLQGF INYACGEVDC GVVQPGGQCY DPNTVLSHAS 60 YVLDLIYIYR KSCNPDIGII TTVDPSYGDC KYP* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-9 | 14 | 67 | 60 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-24 | 14 | 92 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2JON | 1e-19 | 3 | 93 | 1 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| GenBank | AAK58515.1 | 1e-18 | 14 | 93 | 371 | 456 | AF249675_1 beta-1,3-glucanase-like protein [Olea europaea] |
| RefSeq | NP_001144702.1 | 3e-18 | 1 | 92 | 42 | 142 | hypothetical protein LOC100277738 [Zea mays] |
| RefSeq | XP_002451320.1 | 4e-19 | 15 | 92 | 383 | 465 | hypothetical protein SORBIDRAFT_05g027690 [Sorghum bicolor] |
| RefSeq | XP_002461458.1 | 9e-19 | 1 | 92 | 41 | 141 | hypothetical protein SORBIDRAFT_02g002990 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 2e-21 | 3 | 93 | 1 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR181552 | 91 | 4 | 94 | 1e-33 |
| DW155140 | 81 | 14 | 94 | 3e-23 |
| DW155080 | 81 | 14 | 94 | 3e-23 |
| BQ988919 | 81 | 14 | 94 | 2e-20 |
| GR523432 | 84 | 14 | 92 | 3e-20 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |