| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a018783m |
| Family | GH28 |
| Protein Properties | Length: 128 Molecular Weight: 13395.1 Isoelectric Point: 7.7918 |
| Chromosome | Chromosome/Scaffold: 5 Start: 542634 End: 543017 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH28 | 10 | 110 | 6.3e-27 |
| SVQDGTGSVNNVTFSGITMSNVHNPIIIDQNYCNGAHGCSAKTTNAVAISGVTYTDITGTYTVTPVSFVCSKYKACSDLTLSTINLTPSGSAKPNVVCNN A | |||
| Full Sequence |
|---|
| Protein Sequence Length: 128 Download |
| EIKLNFRYNS VQDGTGSVNN VTFSGITMSN VHNPIIIDQN YCNGAHGCSA KTTNAVAISG 60 VTYTDITGTY TVTPVSFVCS KYKACSDLTL STINLTPSGS AKPNVVCNNA FGHVLTPTTP 120 PLTNCLQ* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02218 | PLN02218 | 2.0e-7 | 7 | 95 | 89 | + polygalacturonase ADPG | ||
| PLN03010 | PLN03010 | 6.0e-9 | 7 | 112 | 107 | + polygalacturonase | ||
| PLN02793 | PLN02793 | 5.0e-10 | 7 | 112 | 106 | + Probable polygalacturonase | ||
| PLN02155 | PLN02155 | 2.0e-10 | 15 | 112 | 98 | + polygalacturonase | ||
| pfam00295 | Glyco_hydro_28 | 2.0e-15 | 7 | 110 | 105 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004650 | polygalacturonase activity |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN65317.1 | 5e-23 | 7 | 127 | 253 | 372 | hypothetical protein [Vitis vinifera] |
| RefSeq | NP_196969.1 | 3e-23 | 7 | 127 | 300 | 419 | polygalacturonase, putative / pectinase, putative [Arabidopsis thaliana] |
| RefSeq | XP_002266600.1 | 9e-23 | 7 | 127 | 370 | 489 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002311773.1 | 7e-23 | 7 | 127 | 382 | 501 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002314612.1 | 1e-22 | 7 | 127 | 247 | 366 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2iq7_G | 0.00000003 | 7 | 109 | 231 | 330 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_F | 0.00000003 | 7 | 109 | 231 | 330 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_E | 0.00000003 | 7 | 109 | 231 | 330 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_D | 0.00000003 | 7 | 109 | 231 | 330 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_C | 0.00000003 | 7 | 109 | 231 | 330 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GO999085 | 112 | 7 | 114 | 0.0000000000001 |
| FR637501 | 91 | 7 | 97 | 0.0000000000002 |
| DN910073 | 91 | 7 | 97 | 0.0000000000005 |
| DN909663 | 91 | 7 | 97 | 0.0000000000006 |
| FS345758 | 123 | 7 | 127 | 0.0000000000008 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |