| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a019418m |
| Family | GT1 |
| Protein Properties | Length: 157 Molecular Weight: 17928.7 Isoelectric Point: 6.7668 |
| Chromosome | Chromosome/Scaffold: 223 Start: 366517 End: 367024 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 29 | 132 | 5.1e-23 |
| DNFRVESKEKGLIIPWCDQIRVLSDPAIGGFFTHCGWNSIPESVWCGVPMICYPLEYDQPTNRKLVNDDWKIGIKVAKKIKKLMSGDLKHEVKKVNRILE NDLG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 157 Download |
| KMDIAYGLLL SEIDFIWVVQ GDSFDSFMDN FRVESKEKGL IIPWCDQIRV LSDPAIGGFF 60 THCGWNSIPE SVWCGVPMIC YPLEYDQPTN RKLVNDDWKI GIKVAKKIKK LMSGDLKHEV 120 KKVNRILEND LGAVGSSERN FDQFTKHLRN KLFVSD* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02992 | PLN02992 | 3.0e-20 | 3 | 97 | 116 | + coniferyl-alcohol glucosyltransferase | ||
| PLN02152 | PLN02152 | 8.0e-22 | 31 | 148 | 134 | + indole-3-acetate beta-glucosyltransferase | ||
| PLN03007 | PLN03007 | 1.0e-22 | 2 | 94 | 99 | + UDP-glucosyltransferase family protein | ||
| PLN02555 | PLN02555 | 2.0e-23 | 3 | 151 | 179 | + limonoid glucosyltransferase | ||
| PLN02448 | PLN02448 | 2.0e-34 | 2 | 148 | 170 | + UDP-glycosyltransferase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAG80548.1 | 2e-39 | 2 | 144 | 302 | 464 | UDP-glucose:glucosyltransferase [Lycium barbarum] |
| RefSeq | NP_181234.1 | 1.4013e-45 | 2 | 152 | 304 | 474 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
| RefSeq | XP_002276858.1 | 0 | 2 | 152 | 302 | 472 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002314296.1 | 1.99993e-41 | 4 | 152 | 303 | 471 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002523692.1 | 9.94922e-44 | 2 | 152 | 303 | 473 | UDP-glucosyltransferase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2pq6_A | 1e-26 | 2 | 146 | 314 | 475 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2c9z_A | 9e-21 | 4 | 141 | 292 | 443 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2c1z_A | 9e-21 | 4 | 141 | 292 | 443 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2c1x_A | 9e-21 | 4 | 141 | 292 | 443 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 2vg8_A | 5e-20 | 3 | 130 | 288 | 453 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR033171 | 166 | 3 | 156 | 0 |
| GR142171 | 167 | 3 | 157 | 0 |
| EY169215 | 166 | 3 | 152 | 0 |
| EY178654 | 166 | 3 | 152 | 0 |
| GR149094 | 113 | 57 | 157 | 9.80909e-45 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
