| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a019509m |
| Family | CBM43 |
| Protein Properties | Length: 112 Molecular Weight: 12365.2 Isoelectric Point: 8.4653 |
| Chromosome | Chromosome/Scaffold: 274 Start: 248657 End: 249921 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 33 | 108 | 1.2e-23 |
| WCIAQPSAPQEKLQGLIDYACGVVDCSAIQPGGSCYYPNMILSHADYALNQLYRYKSSCNLYIATITSVNPSYGSC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 112 Download |
| PVVNANLQRW FFFPKMFCPT NSASIGRKQV VKWCIAQPSA PQEKLQGLID YACGVVDCSA 60 IQPGGSCYYP NMILSHADYA LNQLYRYKSS CNLYIATITS VNPSYGSCMY S* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-11 | 32 | 92 | 71 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 5.0e-26 | 32 | 110 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACN26761.1 | 3e-19 | 20 | 111 | 221 | 319 | unknown [Zea mays] |
| RefSeq | NP_001058896.1 | 4e-18 | 31 | 110 | 7 | 93 | Os07g0149900 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001141090.1 | 1e-18 | 33 | 111 | 235 | 320 | hypothetical protein LOC100273173 [Zea mays] |
| RefSeq | NP_001148381.1 | 1e-18 | 20 | 111 | 359 | 457 | glucan endo-1,3-beta-glucosidase 7 [Zea mays] |
| RefSeq | XP_002466692.1 | 5e-19 | 28 | 111 | 381 | 471 | hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 5e-17 | 28 | 110 | 8 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR181552 | 85 | 26 | 110 | 2e-29 |
| BI317157 | 122 | 1 | 111 | 5e-21 |
| DW155080 | 78 | 33 | 110 | 1e-20 |
| DW155140 | 78 | 33 | 110 | 1e-20 |
| FL799297 | 86 | 33 | 111 | 4e-20 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |