CAZyme Information

Basic Information
SpeciesMimulus guttatus
Cazyme IDmgv1a019717m
FamilyAA2
Protein PropertiesLength: 348 Molecular Weight: 38790.2 Isoelectric Point: 6.1757
ChromosomeChromosome/Scaffold: 7 Start: 1746477 End: 1749079
DescriptionPeroxidase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2923320
  PDVAPALLRLAFHDCFVKGCDASILLDPTNSTASEKEAFPNQSLRGFDVIDIIKSEVEEACPGVVSCADIVVLAARESVLVAGGPFYPLLTGRKDNKEGS
  LDEANRLPSPQDHLYETLHKFQPKGFTERETITLLGAHSVGTIHCSFFNERLFNFKGSNAPDPSIDADSSQNPGMKMDYEGPRKDFGTLYYRSLLQRKGL
  LFVDQQLTSMAEAQVWVQAYASDLSLFKRDFGLAMMKLSNL
Full Sequence
Protein Sequence     Length: 348     Download
MDFTRKLSFV VFILCVLISL KKKQADINRR GCVASDSPPP LQAPPSHRKL QQNDGGENVL    60
PEGIRYDYYN ESCPSAEQII RSTVQELYEF RPDVAPALLR LAFHDCFVKG CDASILLDPT    120
NSTASEKEAF PNQSLRGFDV IDIIKSEVEE ACPGVVSCAD IVVLAARESV LVAGGPFYPL    180
LTGRKDNKEG SLDEANRLPS PQDHLYETLH KFQPKGFTER ETITLLGAHS VGTIHCSFFN    240
ERLFNFKGSN APDPSIDADS SQNPGMKMDY EGPRKDFGTL YYRSLLQRKG LLFVDQQLTS    300
MAEAQVWVQA YASDLSLFKR DFGLAMMKLS NLHLLNASVG EVRLNCRK 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase7.0e-1872332284+
cd00314plant_peroxidase_like3.0e-2778331286+
pfam00141peroxidase3.0e-6180314236+
PLN03030PLN030308.0e-7862346302+
cd00693secretory_peroxidase6.0e-12963348298+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI36139.10534815402unnamed protein product [Vitis vinifera]
Swiss-ProtO8175505634860399PER48_ARATH RecName: Full=Putative Peroxidase 48; Short=Atperox P48; Flags: Precursor
RefSeqXP_002269658.1043485371PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002279534.10534815367PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002298218.106434816307predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0673485292A Chain A, Peanut Peroxidase
PDB1sch_A0673485292A Chain A, Peanut Peroxidase
PDB1qo4_A0643483302A Chain A, Peanut Peroxidase
PDB1pa2_A0643483302A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1qgj_B0673475296A Chain A, Arabidopsis Thaliana Peroxidase N
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY978467263642920
DT747438273943480
DT762021264573000
CV005782197612560
FR614695224882960
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_024_00148.1Aquca_020_00226.1Aquca_020_00219.1Aquca_020_00225.1
Arabidopsis lyrata857184
Arabidopsis thalianaAT4G33870.1
Brachypodium distachyonBradi2g48050.1
Brassica rapaBra011475Bra024033
Carica papayaevm.model.supercontig_34.24evm.model.supercontig_98.23
Capsella rubellaCarubv10004951mCarubv10006531m
Citrus clementinaCiclev10025449mCiclev10017909mCiclev10026177m
Citrus sinensisorange1.1g035578morange1.1g043399morange1.1g016209m
Cucumis sativusCucsa.239780.1
Eucalyptus grandisEucgr.F01472.1Eucgr.F03025.1
Fragaria vescamrna29953.1-v1.0-hybridmrna29957.1-v1.0-hybridmrna29954.1-v1.0-hybrid
Glycine maxGlyma08g17850.2Glyma15g41280.1
Malus domesticaMDP0000486228MDP0000254277
Manihot esculentacassava4.1_025400m
Medicago truncatulaMedtr4g012870.1
Oryza sativaLOC_Os01g51550.1
Panicum virgatumPavirv00060522m
Phaseolus vulgarisPhvul.005G059500.1Phvul.005G059700.1
Picea abiesMA_177017g0010
Populus trichocarpaPotri.007G067200.1Potri.007G067200.2Potri.001G182400.1
Prunus persicappa018541mppa007961m
Ricinus communis30146.m00360130169.m006321
Setaria italicaSi003773m
Selaginella moellendorffii115533
Sorghum bicolorSb04g019270.1
Thellungiella halophilaThhalv10025607mThhalv10027558m.213.419Thhalv10027558m.213.419
Vitis viniferaGSVIVT01010156001GSVIVT01017084001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny