Basic Information | |
---|---|
Species | Mimulus guttatus |
Cazyme ID | mgv1a019819m |
Family | CBM43 |
Protein Properties | Length: 83 Molecular Weight: 8844.9 Isoelectric Point: 4.7591 |
Chromosome | Chromosome/Scaffold: 2 Start: 775699 End: 776083 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 80 | 4.2e-22 |
WCVVKFTASDAAMQSFIDTACSSGLDCSAIKPGGSCFDPNILRSHASYMLDLNYRKNNVCQQDIGTIAITDPSYGSCH |
Full Sequence |
---|
Protein Sequence Length: 83 Download |
GDWCVVKFTA SDAAMQSFID TACSSGLDCS AIKPGGSCFD PNILRSHASY MLDLNYRKNN 60 VCQQDIGTIA ITDPSYGSCH YP* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-8 | 3 | 60 | 67 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-21 | 3 | 81 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK28052.1 | 1e-18 | 3 | 81 | 31 | 114 | unknown [Arabidopsis thaliana] |
GenBank | ABK28115.1 | 1e-18 | 3 | 81 | 29 | 112 | unknown [Arabidopsis thaliana] |
RefSeq | NP_001078361.1 | 9e-19 | 3 | 81 | 31 | 114 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118954.1 | 1e-18 | 3 | 81 | 29 | 112 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118955.1 | 1e-18 | 3 | 81 | 31 | 114 | unknown protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 4e-19 | 1 | 82 | 11 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GO245609 | 81 | 3 | 83 | 2e-26 |
BQ988919 | 81 | 3 | 83 | 1e-20 |
GR181552 | 82 | 2 | 83 | 1e-19 |
GW897768 | 85 | 3 | 82 | 2e-19 |
DV850394 | 86 | 1 | 81 | 6e-19 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|