| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a019819m |
| Family | CBM43 |
| Protein Properties | Length: 83 Molecular Weight: 8844.9 Isoelectric Point: 4.7591 |
| Chromosome | Chromosome/Scaffold: 2 Start: 775699 End: 776083 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 3 | 80 | 4.2e-22 |
| WCVVKFTASDAAMQSFIDTACSSGLDCSAIKPGGSCFDPNILRSHASYMLDLNYRKNNVCQQDIGTIAITDPSYGSCH | |||
| Full Sequence |
|---|
| Protein Sequence Length: 83 Download |
| GDWCVVKFTA SDAAMQSFID TACSSGLDCS AIKPGGSCFD PNILRSHASY MLDLNYRKNN 60 VCQQDIGTIA ITDPSYGSCH YP* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-8 | 3 | 60 | 67 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 4.0e-21 | 3 | 81 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK28052.1 | 1e-18 | 3 | 81 | 31 | 114 | unknown [Arabidopsis thaliana] |
| GenBank | ABK28115.1 | 1e-18 | 3 | 81 | 29 | 112 | unknown [Arabidopsis thaliana] |
| RefSeq | NP_001078361.1 | 9e-19 | 3 | 81 | 31 | 114 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_001118954.1 | 1e-18 | 3 | 81 | 29 | 112 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_001118955.1 | 1e-18 | 3 | 81 | 31 | 114 | unknown protein [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 4e-19 | 1 | 82 | 11 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GO245609 | 81 | 3 | 83 | 2e-26 |
| BQ988919 | 81 | 3 | 83 | 1e-20 |
| GR181552 | 82 | 2 | 83 | 1e-19 |
| GW897768 | 85 | 3 | 82 | 2e-19 |
| DV850394 | 86 | 1 | 81 | 6e-19 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |