Basic Information | |
---|---|
Species | Mimulus guttatus |
Cazyme ID | mgv1a020101m |
Family | CBM43 |
Protein Properties | Length: 97 Molecular Weight: 10212.6 Isoelectric Point: 4.8293 |
Chromosome | Chromosome/Scaffold: 251 Start: 266802 End: 267192 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 10 | 92 | 1.6e-25 |
WCIAKPSTSQEKLDDIIEFCCTQKGVDCGVIQAGGNCYLPPNKISDASVVMNIFYKLNGKLGFTCDFNRTGLIVTQDPSVGNC |
Full Sequence |
---|
Protein Sequence Length: 97 Download |
GNGNGNGTTW CIAKPSTSQE KLDDIIEFCC TQKGVDCGVI QAGGNCYLPP NKISDASVVM 60 NIFYKLNGKL GFTCDFNRTG LIVTQDPSVG NCIYPA* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 1.0e-11 | 9 | 80 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 2.0e-26 | 9 | 94 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG31507.1 | 3e-22 | 9 | 94 | 32 | 115 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
RefSeq | XP_002273170.1 | 6e-27 | 4 | 94 | 40 | 130 | PREDICTED: similar to At2g43670 [Vitis vinifera] |
RefSeq | XP_002320265.1 | 5e-24 | 8 | 95 | 46 | 133 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002446660.1 | 3e-22 | 9 | 94 | 38 | 121 | hypothetical protein SORBIDRAFT_06g020000 [Sorghum bicolor] |
RefSeq | XP_002515203.1 | 4e-23 | 4 | 87 | 47 | 129 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 4e-19 | 9 | 96 | 12 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CX305853 | 87 | 8 | 94 | 2e-31 |
EY750651 | 95 | 1 | 94 | 4e-30 |
EE986943 | 87 | 9 | 95 | 5e-30 |
HS088013 | 89 | 8 | 96 | 1e-28 |
CX078448 | 97 | 1 | 97 | 2e-28 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |