Basic Information | |
---|---|
Species | Mimulus guttatus |
Cazyme ID | mgv1a020240m |
Family | CBM43 |
Protein Properties | Length: 85 Molecular Weight: 9186.55 Isoelectric Point: 7.7429 |
Chromosome | Chromosome/Scaffold: 274 Start: 250559 End: 250813 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 6 | 82 | 4.7e-23 |
WCIAQPSAPQDKLQGFIDYACGVVDCSAIQPGGSCYYPTIVVSHADYALNMLYRVKGSCNLYIAKIVTDNPSYGSCN |
Full Sequence |
---|
Protein Sequence Length: 85 Download |
KQLVKWCIAQ PSAPQDKLQG FIDYACGVVD CSAIQPGGSC YYPTIVVSHA DYALNMLYRV 60 KGSCNLYIAK IVTDNPSYGS CNYP* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-11 | 5 | 65 | 71 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-24 | 5 | 83 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | EAZ02781.1 | 4e-18 | 4 | 83 | 54 | 140 | hypothetical protein OsI_24906 [Oryza sativa Indica Group] |
GenBank | EAZ38703.1 | 7e-18 | 4 | 83 | 7 | 93 | hypothetical protein OsJ_23103 [Oryza sativa Japonica Group] |
RefSeq | NP_001058896.1 | 3e-18 | 4 | 83 | 7 | 93 | Os07g0149900 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001144702.1 | 5e-18 | 4 | 83 | 56 | 142 | hypothetical protein LOC100277738 [Zea mays] |
RefSeq | XP_002461458.1 | 7e-18 | 4 | 83 | 55 | 141 | hypothetical protein SORBIDRAFT_02g002990 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 4e-18 | 1 | 84 | 8 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GR181552 | 85 | 1 | 85 | 6e-29 |
DW155080 | 80 | 6 | 85 | 2e-21 |
DW155140 | 80 | 6 | 85 | 2e-21 |
BQ988919 | 80 | 6 | 85 | 8e-21 |
GO245609 | 85 | 1 | 85 | 3e-20 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|