| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a020356m |
| Family | CBM43 |
| Protein Properties | Length: 74 Molecular Weight: 7959.95 Isoelectric Point: 4.0104 |
| Chromosome | Chromosome/Scaffold: 112 Start: 623682 End: 623903 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 4 | 60 | 9.5e-22 |
| WCVAKDDADNGQVQQFLDYACSELSCEPIQPGNPCFDPPTVLAHGSYVLNAYFNQFG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 74 Download |
| GVAWCVAKDD ADNGQVQQFL DYACSELSCE PIQPGNPCFD PPTVLAHGSY VLNAYFNQFG 60 VCSPKIGRVV PVDP |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-10 | 4 | 60 | 67 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-18 | 4 | 60 | 58 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_001078788.1 | 0.00000000002 | 4 | 60 | 25 | 82 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_192648.2 | 0.000000000006 | 4 | 60 | 31 | 88 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| Swiss-Prot | P52409 | 0.00000000001 | 1 | 60 | 374 | 433 | E13B_WHEAT RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1- |
| RefSeq | XP_002283660.1 | 0.00000000002 | 1 | 60 | 318 | 378 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
| RefSeq | XP_002532848.1 | 0.000000000001 | 1 | 60 | 358 | 418 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 0.000000000006 | 3 | 60 | 12 | 70 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR191773 | 61 | 1 | 60 | 0.000000000000003 |
| EX937287 | 59 | 4 | 60 | 0.00000000000001 |
| GO245609 | 74 | 1 | 74 | 0.00000000000002 |
| GR152807 | 62 | 1 | 60 | 0.00000000000002 |
| GR167204 | 62 | 1 | 60 | 0.00000000000003 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |