| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a021024m |
| Family | CBM43 |
| Protein Properties | Length: 80 Molecular Weight: 8618.79 Isoelectric Point: 5.5547 |
| Chromosome | Chromosome/Scaffold: 274 Start: 241116 End: 241355 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 2 | 76 | 1.3e-23 |
| CIAQPSAPQEKLQGLIDYACGVVDCSAIQPGGSCYYPNMIVSHADYALNQLYRYKGSCNLYIATITSINPSYGSC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 80 Download |
| YCIAQPSAPQ EKLQGLIDYA CGVVDCSAIQ PGGSCYYPNM IVSHADYALN QLYRYKGSCN 60 LYIATITSIN PSYGSCMYS* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 7.0e-10 | 1 | 58 | 64 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 1.0e-23 | 1 | 78 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACN26761.1 | 6e-18 | 1 | 79 | 234 | 319 | unknown [Zea mays] |
| RefSeq | NP_001058896.1 | 1e-17 | 1 | 78 | 9 | 93 | Os07g0149900 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001141090.1 | 4e-18 | 1 | 79 | 235 | 320 | hypothetical protein LOC100273173 [Zea mays] |
| RefSeq | NP_192452.2 | 3e-18 | 1 | 78 | 23 | 107 | unknown protein [Arabidopsis thaliana] |
| RefSeq | XP_002466692.1 | 2e-17 | 1 | 79 | 386 | 471 | hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 1e-16 | 1 | 78 | 13 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR181552 | 78 | 1 | 78 | 1e-24 |
| DW155140 | 78 | 1 | 78 | 4e-20 |
| DW155080 | 78 | 1 | 78 | 4e-20 |
| FL799297 | 86 | 1 | 79 | 7e-20 |
| EL686339 | 85 | 1 | 78 | 1e-19 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |