| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a023159m |
| Family | CBM43 |
| Protein Properties | Length: 93 Molecular Weight: 10110.2 Isoelectric Point: 4.4085 |
| Chromosome | Chromosome/Scaffold: 23 Start: 764117 End: 764395 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 14 | 89 | 8.6e-22 |
| WCISQANAPQDKLQAFIDYGCGVVDCSTIQLGGRCYDPNTVEGHASYVLDLVYKKQNSCNTDVGIITTVDPSYEGC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 93 Download |
| TKFEPNGHKQ TVNWCISQAN APQDKLQAFI DYGCGVVDCS TIQLGGRCYD PNTVEGHASY 60 VLDLVYKKQN SCNTDVGIIT TVDPSYEGCD YP* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-8 | 14 | 71 | 64 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-21 | 14 | 91 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK95331.1 | 2e-17 | 1 | 92 | 355 | 452 | unknown [Populus trichocarpa] |
| RefSeq | NP_001068545.1 | 5e-16 | 14 | 91 | 347 | 429 | Os11g0704600 [Oryza sativa (japonica cultivar-group)] |
| Swiss-Prot | P52409 | 3e-16 | 14 | 91 | 377 | 459 | E13B_WHEAT RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1- |
| RefSeq | XP_001767901.1 | 5e-16 | 5 | 92 | 359 | 453 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_002451320.1 | 5e-17 | 14 | 91 | 383 | 465 | hypothetical protein SORBIDRAFT_05g027690 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 5e-16 | 9 | 92 | 8 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR181552 | 93 | 1 | 93 | 0 |
| BQ988919 | 81 | 13 | 93 | 2e-20 |
| GO245609 | 91 | 3 | 93 | 5e-20 |
| DW155140 | 81 | 13 | 93 | 1e-18 |
| DW155080 | 81 | 13 | 93 | 1e-18 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |